@charset "UTF-8";
/**
 * Foundation for Sites
 * Version 6.6.3
 * https://get.foundation
 * Licensed under MIT Open Source
 */
@media print, screen and (min-width: 40em) {
  .reveal, .reveal.tiny, .reveal.small, .reveal.large {
    right: auto;
    left: auto;
    margin: 0 auto; } }

/*! normalize.css v8.0.0 | MIT License | github.com/necolas/normalize.css */
html {
  line-height: 1.15;
  -webkit-text-size-adjust: 100%; }

body {
  margin: 0; }

h1 {
  font-size: 2em;
  margin: 0.67em 0; }

hr {
  box-sizing: content-box;
  height: 0;
  overflow: visible; }

pre {
  font-family: monospace, monospace;
  font-size: 1em; }

a {
  background-color: transparent; }

abbr[title] {
  border-bottom: none;
  text-decoration: underline;
  text-decoration: underline dotted; }

b,
strong {
  font-weight: bolder; }

code,
kbd,
samp {
  font-family: monospace, monospace;
  font-size: 1em; }

small {
  font-size: 80%; }

sub,
sup {
  font-size: 75%;
  line-height: 0;
  position: relative;
  vertical-align: baseline; }

sub {
  bottom: -0.25em; }

sup {
  top: -0.5em; }

img {
  border-style: none; }

button,
input,
optgroup,
select,
textarea {
  font-family: inherit;
  font-size: 100%;
  line-height: 1.15;
  margin: 0; }

button,
input {
  overflow: visible; }

button,
select {
  text-transform: none; }

button,
[type="button"],
[type="reset"],
[type="submit"] {
  -webkit-appearance: button; }

button::-moz-focus-inner,
[type="button"]::-moz-focus-inner,
[type="reset"]::-moz-focus-inner,
[type="submit"]::-moz-focus-inner {
  border-style: none;
  padding: 0; }

button:-moz-focusring,
[type="button"]:-moz-focusring,
[type="reset"]:-moz-focusring,
[type="submit"]:-moz-focusring {
  outline: 1px dotted ButtonText; }

fieldset {
  padding: 0.35em 0.75em 0.625em; }

legend {
  box-sizing: border-box;
  color: inherit;
  display: table;
  max-width: 100%;
  padding: 0;
  white-space: normal; }

progress {
  vertical-align: baseline; }

textarea {
  overflow: auto; }

[type="checkbox"],
[type="radio"] {
  box-sizing: border-box;
  padding: 0; }

[type="number"]::-webkit-inner-spin-button,
[type="number"]::-webkit-outer-spin-button {
  height: auto; }

[type="search"] {
  -webkit-appearance: textfield;
  outline-offset: -2px; }

[type="search"]::-webkit-search-decoration {
  -webkit-appearance: none; }

::-webkit-file-upload-button {
  -webkit-appearance: button;
  font: inherit; }

details {
  display: block; }

summary {
  display: list-item; }

template {
  display: none; }

[hidden] {
  display: none; }

.foundation-mq {
  font-family: "small=0em&medium=40em&large=60em&xlarge=80em&xxlarge=100em&xxxlarge=120em"; }

html {
  box-sizing: border-box;
  font-size: 1rem; }

*,
*::before,
*::after {
  box-sizing: inherit; }

body {
  margin: 0;
  padding: 0;
  background: #fefefe;
  font-family: Lato, Helvetica, Arial, sans-serif;
  font-weight: normal;
  line-height: 1.33;
  color: #333333;
  -webkit-font-smoothing: antialiased;
  -moz-osx-font-smoothing: grayscale; }

img {
  display: inline-block;
  vertical-align: middle;
  max-width: 100%;
  height: auto;
  -ms-interpolation-mode: bicubic; }

textarea {
  height: auto;
  min-height: 50px;
  border-radius: 2px; }

select {
  box-sizing: border-box;
  width: 100%;
  border-radius: 2px; }

.map_canvas img,
.map_canvas embed,
.map_canvas object,
.mqa-display img,
.mqa-display embed,
.mqa-display object {
  max-width: none !important; }

button {
  padding: 0;
  -webkit-appearance: none;
     -moz-appearance: none;
          appearance: none;
  border: 0;
  border-radius: 2px;
  background: transparent;
  line-height: 1;
  cursor: auto; }
  [data-whatinput='mouse'] button {
    outline: 0; }

pre {
  overflow: auto; }

button,
input,
optgroup,
select,
textarea {
  font-family: inherit; }

.is-visible {
  display: block !important; }

.is-hidden {
  display: none !important; }

.row {
  max-width: 75rem;
  margin-right: auto;
  margin-left: auto; }
  .row::before, .row::after {
    display: table;
    content: ' '; }
  .row::after {
    clear: both; }
  .row.collapse > .column, .row.collapse > .columns {
    padding-right: 0;
    padding-left: 0; }
  .row .row {
    margin-right: -0.875rem;
    margin-left: -0.875rem; }
    @media print, screen and (min-width: 40em) {
      .row .row {
        margin-right: -0.875rem;
        margin-left: -0.875rem; } }
    @media print, screen and (min-width: 60em) {
      .row .row {
        margin-right: -0.875rem;
        margin-left: -0.875rem; } }
    @media screen and (min-width: 80em) {
      .row .row {
        margin-right: -0.875rem;
        margin-left: -0.875rem; } }
    @media screen and (min-width: 100em) {
      .row .row {
        margin-right: -0.875rem;
        margin-left: -0.875rem; } }
    @media screen and (min-width: 120em) {
      .row .row {
        margin-right: -0.875rem;
        margin-left: -0.875rem; } }
    .row .row.collapse {
      margin-right: 0;
      margin-left: 0; }
  .row.expanded {
    max-width: none; }
    .row.expanded .row {
      margin-right: auto;
      margin-left: auto; }
  .row:not(.expanded) .row {
    max-width: none; }
  .row.gutter-small > .column, .row.gutter-small > .columns {
    padding-right: 0.875rem;
    padding-left: 0.875rem; }
  .row.gutter-medium > .column, .row.gutter-medium > .columns {
    padding-right: 0.875rem;
    padding-left: 0.875rem; }

.column, .columns {
  width: 100%;
  float: left;
  padding-right: 0.875rem;
  padding-left: 0.875rem; }
  @media print, screen and (min-width: 40em) {
    .column, .columns {
      padding-right: 0.875rem;
      padding-left: 0.875rem; } }
  .column, .columns, .column:last-child:not(:first-child), .columns:last-child:not(:first-child) {
    float: left;
    clear: none; }
  .column:last-child:not(:first-child), .columns:last-child:not(:first-child) {
    float: right; }
  .column.end:last-child:last-child, .end.columns:last-child:last-child {
    float: left; }

.column.row.row, .row.row.columns {
  float: none; }

.row .column.row.row, .row .row.row.columns {
  margin-right: 0;
  margin-left: 0;
  padding-right: 0;
  padding-left: 0; }

.small-1 {
  width: 8.33333%; }

.small-push-1 {
  position: relative;
  left: 8.33333%; }

.small-pull-1 {
  position: relative;
  left: -8.33333%; }

.small-offset-0 {
  margin-left: 0%; }

.small-2 {
  width: 16.66667%; }

.small-push-2 {
  position: relative;
  left: 16.66667%; }

.small-pull-2 {
  position: relative;
  left: -16.66667%; }

.small-offset-1 {
  margin-left: 8.33333%; }

.small-3 {
  width: 25%; }

.small-push-3 {
  position: relative;
  left: 25%; }

.small-pull-3 {
  position: relative;
  left: -25%; }

.small-offset-2 {
  margin-left: 16.66667%; }

.small-4 {
  width: 33.33333%; }

.small-push-4 {
  position: relative;
  left: 33.33333%; }

.small-pull-4 {
  position: relative;
  left: -33.33333%; }

.small-offset-3 {
  margin-left: 25%; }

.small-5 {
  width: 41.66667%; }

.small-push-5 {
  position: relative;
  left: 41.66667%; }

.small-pull-5 {
  position: relative;
  left: -41.66667%; }

.small-offset-4 {
  margin-left: 33.33333%; }

.small-6 {
  width: 50%; }

.small-push-6 {
  position: relative;
  left: 50%; }

.small-pull-6 {
  position: relative;
  left: -50%; }

.small-offset-5 {
  margin-left: 41.66667%; }

.small-7 {
  width: 58.33333%; }

.small-push-7 {
  position: relative;
  left: 58.33333%; }

.small-pull-7 {
  position: relative;
  left: -58.33333%; }

.small-offset-6 {
  margin-left: 50%; }

.small-8 {
  width: 66.66667%; }

.small-push-8 {
  position: relative;
  left: 66.66667%; }

.small-pull-8 {
  position: relative;
  left: -66.66667%; }

.small-offset-7 {
  margin-left: 58.33333%; }

.small-9 {
  width: 75%; }

.small-push-9 {
  position: relative;
  left: 75%; }

.small-pull-9 {
  position: relative;
  left: -75%; }

.small-offset-8 {
  margin-left: 66.66667%; }

.small-10 {
  width: 83.33333%; }

.small-push-10 {
  position: relative;
  left: 83.33333%; }

.small-pull-10 {
  position: relative;
  left: -83.33333%; }

.small-offset-9 {
  margin-left: 75%; }

.small-11 {
  width: 91.66667%; }

.small-push-11 {
  position: relative;
  left: 91.66667%; }

.small-pull-11 {
  position: relative;
  left: -91.66667%; }

.small-offset-10 {
  margin-left: 83.33333%; }

.small-12 {
  width: 100%; }

.small-offset-11 {
  margin-left: 91.66667%; }

.small-up-1 > .column, .small-up-1 > .columns {
  float: left;
  width: 100%; }
  .small-up-1 > .column:nth-of-type(1n), .small-up-1 > .columns:nth-of-type(1n) {
    clear: none; }
  .small-up-1 > .column:nth-of-type(1n+1), .small-up-1 > .columns:nth-of-type(1n+1) {
    clear: both; }
  .small-up-1 > .column:last-child, .small-up-1 > .columns:last-child {
    float: left; }

.small-up-2 > .column, .small-up-2 > .columns {
  float: left;
  width: 50%; }
  .small-up-2 > .column:nth-of-type(1n), .small-up-2 > .columns:nth-of-type(1n) {
    clear: none; }
  .small-up-2 > .column:nth-of-type(2n+1), .small-up-2 > .columns:nth-of-type(2n+1) {
    clear: both; }
  .small-up-2 > .column:last-child, .small-up-2 > .columns:last-child {
    float: left; }

.small-up-3 > .column, .small-up-3 > .columns {
  float: left;
  width: 33.33333%; }
  .small-up-3 > .column:nth-of-type(1n), .small-up-3 > .columns:nth-of-type(1n) {
    clear: none; }
  .small-up-3 > .column:nth-of-type(3n+1), .small-up-3 > .columns:nth-of-type(3n+1) {
    clear: both; }
  .small-up-3 > .column:last-child, .small-up-3 > .columns:last-child {
    float: left; }

.small-up-4 > .column, .small-up-4 > .columns {
  float: left;
  width: 25%; }
  .small-up-4 > .column:nth-of-type(1n), .small-up-4 > .columns:nth-of-type(1n) {
    clear: none; }
  .small-up-4 > .column:nth-of-type(4n+1), .small-up-4 > .columns:nth-of-type(4n+1) {
    clear: both; }
  .small-up-4 > .column:last-child, .small-up-4 > .columns:last-child {
    float: left; }

.small-up-5 > .column, .small-up-5 > .columns {
  float: left;
  width: 20%; }
  .small-up-5 > .column:nth-of-type(1n), .small-up-5 > .columns:nth-of-type(1n) {
    clear: none; }
  .small-up-5 > .column:nth-of-type(5n+1), .small-up-5 > .columns:nth-of-type(5n+1) {
    clear: both; }
  .small-up-5 > .column:last-child, .small-up-5 > .columns:last-child {
    float: left; }

.small-up-6 > .column, .small-up-6 > .columns {
  float: left;
  width: 16.66667%; }
  .small-up-6 > .column:nth-of-type(1n), .small-up-6 > .columns:nth-of-type(1n) {
    clear: none; }
  .small-up-6 > .column:nth-of-type(6n+1), .small-up-6 > .columns:nth-of-type(6n+1) {
    clear: both; }
  .small-up-6 > .column:last-child, .small-up-6 > .columns:last-child {
    float: left; }

.small-up-7 > .column, .small-up-7 > .columns {
  float: left;
  width: 14.28571%; }
  .small-up-7 > .column:nth-of-type(1n), .small-up-7 > .columns:nth-of-type(1n) {
    clear: none; }
  .small-up-7 > .column:nth-of-type(7n+1), .small-up-7 > .columns:nth-of-type(7n+1) {
    clear: both; }
  .small-up-7 > .column:last-child, .small-up-7 > .columns:last-child {
    float: left; }

.small-up-8 > .column, .small-up-8 > .columns {
  float: left;
  width: 12.5%; }
  .small-up-8 > .column:nth-of-type(1n), .small-up-8 > .columns:nth-of-type(1n) {
    clear: none; }
  .small-up-8 > .column:nth-of-type(8n+1), .small-up-8 > .columns:nth-of-type(8n+1) {
    clear: both; }
  .small-up-8 > .column:last-child, .small-up-8 > .columns:last-child {
    float: left; }

.small-up-9 > .column, .small-up-9 > .columns {
  float: left;
  width: 11.11111%; }
  .small-up-9 > .column:nth-of-type(1n), .small-up-9 > .columns:nth-of-type(1n) {
    clear: none; }
  .small-up-9 > .column:nth-of-type(9n+1), .small-up-9 > .columns:nth-of-type(9n+1) {
    clear: both; }
  .small-up-9 > .column:last-child, .small-up-9 > .columns:last-child {
    float: left; }

.small-up-10 > .column, .small-up-10 > .columns {
  float: left;
  width: 10%; }
  .small-up-10 > .column:nth-of-type(1n), .small-up-10 > .columns:nth-of-type(1n) {
    clear: none; }
  .small-up-10 > .column:nth-of-type(10n+1), .small-up-10 > .columns:nth-of-type(10n+1) {
    clear: both; }
  .small-up-10 > .column:last-child, .small-up-10 > .columns:last-child {
    float: left; }

.small-up-11 > .column, .small-up-11 > .columns {
  float: left;
  width: 9.09091%; }
  .small-up-11 > .column:nth-of-type(1n), .small-up-11 > .columns:nth-of-type(1n) {
    clear: none; }
  .small-up-11 > .column:nth-of-type(11n+1), .small-up-11 > .columns:nth-of-type(11n+1) {
    clear: both; }
  .small-up-11 > .column:last-child, .small-up-11 > .columns:last-child {
    float: left; }

.small-up-12 > .column, .small-up-12 > .columns {
  float: left;
  width: 8.33333%; }
  .small-up-12 > .column:nth-of-type(1n), .small-up-12 > .columns:nth-of-type(1n) {
    clear: none; }
  .small-up-12 > .column:nth-of-type(12n+1), .small-up-12 > .columns:nth-of-type(12n+1) {
    clear: both; }
  .small-up-12 > .column:last-child, .small-up-12 > .columns:last-child {
    float: left; }

.small-up-13 > .column, .small-up-13 > .columns {
  float: left;
  width: 7.69231%; }
  .small-up-13 > .column:nth-of-type(1n), .small-up-13 > .columns:nth-of-type(1n) {
    clear: none; }
  .small-up-13 > .column:nth-of-type(13n+1), .small-up-13 > .columns:nth-of-type(13n+1) {
    clear: both; }
  .small-up-13 > .column:last-child, .small-up-13 > .columns:last-child {
    float: left; }

.small-up-14 > .column, .small-up-14 > .columns {
  float: left;
  width: 7.14286%; }
  .small-up-14 > .column:nth-of-type(1n), .small-up-14 > .columns:nth-of-type(1n) {
    clear: none; }
  .small-up-14 > .column:nth-of-type(14n+1), .small-up-14 > .columns:nth-of-type(14n+1) {
    clear: both; }
  .small-up-14 > .column:last-child, .small-up-14 > .columns:last-child {
    float: left; }

.small-up-15 > .column, .small-up-15 > .columns {
  float: left;
  width: 6.66667%; }
  .small-up-15 > .column:nth-of-type(1n), .small-up-15 > .columns:nth-of-type(1n) {
    clear: none; }
  .small-up-15 > .column:nth-of-type(15n+1), .small-up-15 > .columns:nth-of-type(15n+1) {
    clear: both; }
  .small-up-15 > .column:last-child, .small-up-15 > .columns:last-child {
    float: left; }

.small-up-16 > .column, .small-up-16 > .columns {
  float: left;
  width: 6.25%; }
  .small-up-16 > .column:nth-of-type(1n), .small-up-16 > .columns:nth-of-type(1n) {
    clear: none; }
  .small-up-16 > .column:nth-of-type(16n+1), .small-up-16 > .columns:nth-of-type(16n+1) {
    clear: both; }
  .small-up-16 > .column:last-child, .small-up-16 > .columns:last-child {
    float: left; }

.small-collapse > .column, .small-collapse > .columns {
  padding-right: 0;
  padding-left: 0; }

.small-collapse .row {
  margin-right: 0;
  margin-left: 0; }

.expanded.row .small-collapse.row {
  margin-right: 0;
  margin-left: 0; }

.small-uncollapse > .column, .small-uncollapse > .columns {
  padding-right: 0.875rem;
  padding-left: 0.875rem; }

.small-centered {
  margin-right: auto;
  margin-left: auto; }
  .small-centered, .small-centered:last-child:not(:first-child) {
    float: none;
    clear: both; }

.small-uncentered, .small-push-0, .small-pull-0 {
  position: static;
  margin-right: 0;
  margin-left: 0; }
  .small-uncentered, .small-uncentered:last-child:not(:first-child), .small-push-0, .small-push-0:last-child:not(:first-child), .small-pull-0, .small-pull-0:last-child:not(:first-child) {
    float: left;
    clear: none; }
  .small-uncentered:last-child:not(:first-child), .small-push-0:last-child:not(:first-child), .small-pull-0:last-child:not(:first-child) {
    float: right; }

@media print, screen and (min-width: 40em) {
  .medium-1 {
    width: 8.33333%; }
  .medium-push-1 {
    position: relative;
    left: 8.33333%; }
  .medium-pull-1 {
    position: relative;
    left: -8.33333%; }
  .medium-offset-0 {
    margin-left: 0%; }
  .medium-2 {
    width: 16.66667%; }
  .medium-push-2 {
    position: relative;
    left: 16.66667%; }
  .medium-pull-2 {
    position: relative;
    left: -16.66667%; }
  .medium-offset-1 {
    margin-left: 8.33333%; }
  .medium-3 {
    width: 25%; }
  .medium-push-3 {
    position: relative;
    left: 25%; }
  .medium-pull-3 {
    position: relative;
    left: -25%; }
  .medium-offset-2 {
    margin-left: 16.66667%; }
  .medium-4 {
    width: 33.33333%; }
  .medium-push-4 {
    position: relative;
    left: 33.33333%; }
  .medium-pull-4 {
    position: relative;
    left: -33.33333%; }
  .medium-offset-3 {
    margin-left: 25%; }
  .medium-5 {
    width: 41.66667%; }
  .medium-push-5 {
    position: relative;
    left: 41.66667%; }
  .medium-pull-5 {
    position: relative;
    left: -41.66667%; }
  .medium-offset-4 {
    margin-left: 33.33333%; }
  .medium-6 {
    width: 50%; }
  .medium-push-6 {
    position: relative;
    left: 50%; }
  .medium-pull-6 {
    position: relative;
    left: -50%; }
  .medium-offset-5 {
    margin-left: 41.66667%; }
  .medium-7 {
    width: 58.33333%; }
  .medium-push-7 {
    position: relative;
    left: 58.33333%; }
  .medium-pull-7 {
    position: relative;
    left: -58.33333%; }
  .medium-offset-6 {
    margin-left: 50%; }
  .medium-8 {
    width: 66.66667%; }
  .medium-push-8 {
    position: relative;
    left: 66.66667%; }
  .medium-pull-8 {
    position: relative;
    left: -66.66667%; }
  .medium-offset-7 {
    margin-left: 58.33333%; }
  .medium-9 {
    width: 75%; }
  .medium-push-9 {
    position: relative;
    left: 75%; }
  .medium-pull-9 {
    position: relative;
    left: -75%; }
  .medium-offset-8 {
    margin-left: 66.66667%; }
  .medium-10 {
    width: 83.33333%; }
  .medium-push-10 {
    position: relative;
    left: 83.33333%; }
  .medium-pull-10 {
    position: relative;
    left: -83.33333%; }
  .medium-offset-9 {
    margin-left: 75%; }
  .medium-11 {
    width: 91.66667%; }
  .medium-push-11 {
    position: relative;
    left: 91.66667%; }
  .medium-pull-11 {
    position: relative;
    left: -91.66667%; }
  .medium-offset-10 {
    margin-left: 83.33333%; }
  .medium-12 {
    width: 100%; }
  .medium-offset-11 {
    margin-left: 91.66667%; }
  .medium-up-1 > .column, .medium-up-1 > .columns {
    float: left;
    width: 100%; }
    .medium-up-1 > .column:nth-of-type(1n), .medium-up-1 > .columns:nth-of-type(1n) {
      clear: none; }
    .medium-up-1 > .column:nth-of-type(1n+1), .medium-up-1 > .columns:nth-of-type(1n+1) {
      clear: both; }
    .medium-up-1 > .column:last-child, .medium-up-1 > .columns:last-child {
      float: left; }
  .medium-up-2 > .column, .medium-up-2 > .columns {
    float: left;
    width: 50%; }
    .medium-up-2 > .column:nth-of-type(1n), .medium-up-2 > .columns:nth-of-type(1n) {
      clear: none; }
    .medium-up-2 > .column:nth-of-type(2n+1), .medium-up-2 > .columns:nth-of-type(2n+1) {
      clear: both; }
    .medium-up-2 > .column:last-child, .medium-up-2 > .columns:last-child {
      float: left; }
  .medium-up-3 > .column, .medium-up-3 > .columns {
    float: left;
    width: 33.33333%; }
    .medium-up-3 > .column:nth-of-type(1n), .medium-up-3 > .columns:nth-of-type(1n) {
      clear: none; }
    .medium-up-3 > .column:nth-of-type(3n+1), .medium-up-3 > .columns:nth-of-type(3n+1) {
      clear: both; }
    .medium-up-3 > .column:last-child, .medium-up-3 > .columns:last-child {
      float: left; }
  .medium-up-4 > .column, .medium-up-4 > .columns {
    float: left;
    width: 25%; }
    .medium-up-4 > .column:nth-of-type(1n), .medium-up-4 > .columns:nth-of-type(1n) {
      clear: none; }
    .medium-up-4 > .column:nth-of-type(4n+1), .medium-up-4 > .columns:nth-of-type(4n+1) {
      clear: both; }
    .medium-up-4 > .column:last-child, .medium-up-4 > .columns:last-child {
      float: left; }
  .medium-up-5 > .column, .medium-up-5 > .columns {
    float: left;
    width: 20%; }
    .medium-up-5 > .column:nth-of-type(1n), .medium-up-5 > .columns:nth-of-type(1n) {
      clear: none; }
    .medium-up-5 > .column:nth-of-type(5n+1), .medium-up-5 > .columns:nth-of-type(5n+1) {
      clear: both; }
    .medium-up-5 > .column:last-child, .medium-up-5 > .columns:last-child {
      float: left; }
  .medium-up-6 > .column, .medium-up-6 > .columns {
    float: left;
    width: 16.66667%; }
    .medium-up-6 > .column:nth-of-type(1n), .medium-up-6 > .columns:nth-of-type(1n) {
      clear: none; }
    .medium-up-6 > .column:nth-of-type(6n+1), .medium-up-6 > .columns:nth-of-type(6n+1) {
      clear: both; }
    .medium-up-6 > .column:last-child, .medium-up-6 > .columns:last-child {
      float: left; }
  .medium-up-7 > .column, .medium-up-7 > .columns {
    float: left;
    width: 14.28571%; }
    .medium-up-7 > .column:nth-of-type(1n), .medium-up-7 > .columns:nth-of-type(1n) {
      clear: none; }
    .medium-up-7 > .column:nth-of-type(7n+1), .medium-up-7 > .columns:nth-of-type(7n+1) {
      clear: both; }
    .medium-up-7 > .column:last-child, .medium-up-7 > .columns:last-child {
      float: left; }
  .medium-up-8 > .column, .medium-up-8 > .columns {
    float: left;
    width: 12.5%; }
    .medium-up-8 > .column:nth-of-type(1n), .medium-up-8 > .columns:nth-of-type(1n) {
      clear: none; }
    .medium-up-8 > .column:nth-of-type(8n+1), .medium-up-8 > .columns:nth-of-type(8n+1) {
      clear: both; }
    .medium-up-8 > .column:last-child, .medium-up-8 > .columns:last-child {
      float: left; }
  .medium-up-9 > .column, .medium-up-9 > .columns {
    float: left;
    width: 11.11111%; }
    .medium-up-9 > .column:nth-of-type(1n), .medium-up-9 > .columns:nth-of-type(1n) {
      clear: none; }
    .medium-up-9 > .column:nth-of-type(9n+1), .medium-up-9 > .columns:nth-of-type(9n+1) {
      clear: both; }
    .medium-up-9 > .column:last-child, .medium-up-9 > .columns:last-child {
      float: left; }
  .medium-up-10 > .column, .medium-up-10 > .columns {
    float: left;
    width: 10%; }
    .medium-up-10 > .column:nth-of-type(1n), .medium-up-10 > .columns:nth-of-type(1n) {
      clear: none; }
    .medium-up-10 > .column:nth-of-type(10n+1), .medium-up-10 > .columns:nth-of-type(10n+1) {
      clear: both; }
    .medium-up-10 > .column:last-child, .medium-up-10 > .columns:last-child {
      float: left; }
  .medium-up-11 > .column, .medium-up-11 > .columns {
    float: left;
    width: 9.09091%; }
    .medium-up-11 > .column:nth-of-type(1n), .medium-up-11 > .columns:nth-of-type(1n) {
      clear: none; }
    .medium-up-11 > .column:nth-of-type(11n+1), .medium-up-11 > .columns:nth-of-type(11n+1) {
      clear: both; }
    .medium-up-11 > .column:last-child, .medium-up-11 > .columns:last-child {
      float: left; }
  .medium-up-12 > .column, .medium-up-12 > .columns {
    float: left;
    width: 8.33333%; }
    .medium-up-12 > .column:nth-of-type(1n), .medium-up-12 > .columns:nth-of-type(1n) {
      clear: none; }
    .medium-up-12 > .column:nth-of-type(12n+1), .medium-up-12 > .columns:nth-of-type(12n+1) {
      clear: both; }
    .medium-up-12 > .column:last-child, .medium-up-12 > .columns:last-child {
      float: left; }
  .medium-up-13 > .column, .medium-up-13 > .columns {
    float: left;
    width: 7.69231%; }
    .medium-up-13 > .column:nth-of-type(1n), .medium-up-13 > .columns:nth-of-type(1n) {
      clear: none; }
    .medium-up-13 > .column:nth-of-type(13n+1), .medium-up-13 > .columns:nth-of-type(13n+1) {
      clear: both; }
    .medium-up-13 > .column:last-child, .medium-up-13 > .columns:last-child {
      float: left; }
  .medium-up-14 > .column, .medium-up-14 > .columns {
    float: left;
    width: 7.14286%; }
    .medium-up-14 > .column:nth-of-type(1n), .medium-up-14 > .columns:nth-of-type(1n) {
      clear: none; }
    .medium-up-14 > .column:nth-of-type(14n+1), .medium-up-14 > .columns:nth-of-type(14n+1) {
      clear: both; }
    .medium-up-14 > .column:last-child, .medium-up-14 > .columns:last-child {
      float: left; }
  .medium-up-15 > .column, .medium-up-15 > .columns {
    float: left;
    width: 6.66667%; }
    .medium-up-15 > .column:nth-of-type(1n), .medium-up-15 > .columns:nth-of-type(1n) {
      clear: none; }
    .medium-up-15 > .column:nth-of-type(15n+1), .medium-up-15 > .columns:nth-of-type(15n+1) {
      clear: both; }
    .medium-up-15 > .column:last-child, .medium-up-15 > .columns:last-child {
      float: left; }
  .medium-up-16 > .column, .medium-up-16 > .columns {
    float: left;
    width: 6.25%; }
    .medium-up-16 > .column:nth-of-type(1n), .medium-up-16 > .columns:nth-of-type(1n) {
      clear: none; }
    .medium-up-16 > .column:nth-of-type(16n+1), .medium-up-16 > .columns:nth-of-type(16n+1) {
      clear: both; }
    .medium-up-16 > .column:last-child, .medium-up-16 > .columns:last-child {
      float: left; }
  .medium-collapse > .column, .medium-collapse > .columns {
    padding-right: 0;
    padding-left: 0; }
  .medium-collapse .row {
    margin-right: 0;
    margin-left: 0; }
  .expanded.row .medium-collapse.row {
    margin-right: 0;
    margin-left: 0; }
  .medium-uncollapse > .column, .medium-uncollapse > .columns {
    padding-right: 0.875rem;
    padding-left: 0.875rem; }
  .medium-centered {
    margin-right: auto;
    margin-left: auto; }
    .medium-centered, .medium-centered:last-child:not(:first-child) {
      float: none;
      clear: both; }
  .medium-uncentered, .medium-push-0, .medium-pull-0 {
    position: static;
    margin-right: 0;
    margin-left: 0; }
    .medium-uncentered, .medium-uncentered:last-child:not(:first-child), .medium-push-0, .medium-push-0:last-child:not(:first-child), .medium-pull-0, .medium-pull-0:last-child:not(:first-child) {
      float: left;
      clear: none; }
    .medium-uncentered:last-child:not(:first-child), .medium-push-0:last-child:not(:first-child), .medium-pull-0:last-child:not(:first-child) {
      float: right; } }

@media print, screen and (min-width: 60em) {
  .large-1 {
    width: 8.33333%; }
  .large-push-1 {
    position: relative;
    left: 8.33333%; }
  .large-pull-1 {
    position: relative;
    left: -8.33333%; }
  .large-offset-0 {
    margin-left: 0%; }
  .large-2 {
    width: 16.66667%; }
  .large-push-2 {
    position: relative;
    left: 16.66667%; }
  .large-pull-2 {
    position: relative;
    left: -16.66667%; }
  .large-offset-1 {
    margin-left: 8.33333%; }
  .large-3 {
    width: 25%; }
  .large-push-3 {
    position: relative;
    left: 25%; }
  .large-pull-3 {
    position: relative;
    left: -25%; }
  .large-offset-2 {
    margin-left: 16.66667%; }
  .large-4 {
    width: 33.33333%; }
  .large-push-4 {
    position: relative;
    left: 33.33333%; }
  .large-pull-4 {
    position: relative;
    left: -33.33333%; }
  .large-offset-3 {
    margin-left: 25%; }
  .large-5 {
    width: 41.66667%; }
  .large-push-5 {
    position: relative;
    left: 41.66667%; }
  .large-pull-5 {
    position: relative;
    left: -41.66667%; }
  .large-offset-4 {
    margin-left: 33.33333%; }
  .large-6 {
    width: 50%; }
  .large-push-6 {
    position: relative;
    left: 50%; }
  .large-pull-6 {
    position: relative;
    left: -50%; }
  .large-offset-5 {
    margin-left: 41.66667%; }
  .large-7 {
    width: 58.33333%; }
  .large-push-7 {
    position: relative;
    left: 58.33333%; }
  .large-pull-7 {
    position: relative;
    left: -58.33333%; }
  .large-offset-6 {
    margin-left: 50%; }
  .large-8 {
    width: 66.66667%; }
  .large-push-8 {
    position: relative;
    left: 66.66667%; }
  .large-pull-8 {
    position: relative;
    left: -66.66667%; }
  .large-offset-7 {
    margin-left: 58.33333%; }
  .large-9 {
    width: 75%; }
  .large-push-9 {
    position: relative;
    left: 75%; }
  .large-pull-9 {
    position: relative;
    left: -75%; }
  .large-offset-8 {
    margin-left: 66.66667%; }
  .large-10 {
    width: 83.33333%; }
  .large-push-10 {
    position: relative;
    left: 83.33333%; }
  .large-pull-10 {
    position: relative;
    left: -83.33333%; }
  .large-offset-9 {
    margin-left: 75%; }
  .large-11 {
    width: 91.66667%; }
  .large-push-11 {
    position: relative;
    left: 91.66667%; }
  .large-pull-11 {
    position: relative;
    left: -91.66667%; }
  .large-offset-10 {
    margin-left: 83.33333%; }
  .large-12 {
    width: 100%; }
  .large-offset-11 {
    margin-left: 91.66667%; }
  .large-up-1 > .column, .large-up-1 > .columns {
    float: left;
    width: 100%; }
    .large-up-1 > .column:nth-of-type(1n), .large-up-1 > .columns:nth-of-type(1n) {
      clear: none; }
    .large-up-1 > .column:nth-of-type(1n+1), .large-up-1 > .columns:nth-of-type(1n+1) {
      clear: both; }
    .large-up-1 > .column:last-child, .large-up-1 > .columns:last-child {
      float: left; }
  .large-up-2 > .column, .large-up-2 > .columns {
    float: left;
    width: 50%; }
    .large-up-2 > .column:nth-of-type(1n), .large-up-2 > .columns:nth-of-type(1n) {
      clear: none; }
    .large-up-2 > .column:nth-of-type(2n+1), .large-up-2 > .columns:nth-of-type(2n+1) {
      clear: both; }
    .large-up-2 > .column:last-child, .large-up-2 > .columns:last-child {
      float: left; }
  .large-up-3 > .column, .large-up-3 > .columns {
    float: left;
    width: 33.33333%; }
    .large-up-3 > .column:nth-of-type(1n), .large-up-3 > .columns:nth-of-type(1n) {
      clear: none; }
    .large-up-3 > .column:nth-of-type(3n+1), .large-up-3 > .columns:nth-of-type(3n+1) {
      clear: both; }
    .large-up-3 > .column:last-child, .large-up-3 > .columns:last-child {
      float: left; }
  .large-up-4 > .column, .large-up-4 > .columns {
    float: left;
    width: 25%; }
    .large-up-4 > .column:nth-of-type(1n), .large-up-4 > .columns:nth-of-type(1n) {
      clear: none; }
    .large-up-4 > .column:nth-of-type(4n+1), .large-up-4 > .columns:nth-of-type(4n+1) {
      clear: both; }
    .large-up-4 > .column:last-child, .large-up-4 > .columns:last-child {
      float: left; }
  .large-up-5 > .column, .large-up-5 > .columns {
    float: left;
    width: 20%; }
    .large-up-5 > .column:nth-of-type(1n), .large-up-5 > .columns:nth-of-type(1n) {
      clear: none; }
    .large-up-5 > .column:nth-of-type(5n+1), .large-up-5 > .columns:nth-of-type(5n+1) {
      clear: both; }
    .large-up-5 > .column:last-child, .large-up-5 > .columns:last-child {
      float: left; }
  .large-up-6 > .column, .large-up-6 > .columns {
    float: left;
    width: 16.66667%; }
    .large-up-6 > .column:nth-of-type(1n), .large-up-6 > .columns:nth-of-type(1n) {
      clear: none; }
    .large-up-6 > .column:nth-of-type(6n+1), .large-up-6 > .columns:nth-of-type(6n+1) {
      clear: both; }
    .large-up-6 > .column:last-child, .large-up-6 > .columns:last-child {
      float: left; }
  .large-up-7 > .column, .large-up-7 > .columns {
    float: left;
    width: 14.28571%; }
    .large-up-7 > .column:nth-of-type(1n), .large-up-7 > .columns:nth-of-type(1n) {
      clear: none; }
    .large-up-7 > .column:nth-of-type(7n+1), .large-up-7 > .columns:nth-of-type(7n+1) {
      clear: both; }
    .large-up-7 > .column:last-child, .large-up-7 > .columns:last-child {
      float: left; }
  .large-up-8 > .column, .large-up-8 > .columns {
    float: left;
    width: 12.5%; }
    .large-up-8 > .column:nth-of-type(1n), .large-up-8 > .columns:nth-of-type(1n) {
      clear: none; }
    .large-up-8 > .column:nth-of-type(8n+1), .large-up-8 > .columns:nth-of-type(8n+1) {
      clear: both; }
    .large-up-8 > .column:last-child, .large-up-8 > .columns:last-child {
      float: left; }
  .large-up-9 > .column, .large-up-9 > .columns {
    float: left;
    width: 11.11111%; }
    .large-up-9 > .column:nth-of-type(1n), .large-up-9 > .columns:nth-of-type(1n) {
      clear: none; }
    .large-up-9 > .column:nth-of-type(9n+1), .large-up-9 > .columns:nth-of-type(9n+1) {
      clear: both; }
    .large-up-9 > .column:last-child, .large-up-9 > .columns:last-child {
      float: left; }
  .large-up-10 > .column, .large-up-10 > .columns {
    float: left;
    width: 10%; }
    .large-up-10 > .column:nth-of-type(1n), .large-up-10 > .columns:nth-of-type(1n) {
      clear: none; }
    .large-up-10 > .column:nth-of-type(10n+1), .large-up-10 > .columns:nth-of-type(10n+1) {
      clear: both; }
    .large-up-10 > .column:last-child, .large-up-10 > .columns:last-child {
      float: left; }
  .large-up-11 > .column, .large-up-11 > .columns {
    float: left;
    width: 9.09091%; }
    .large-up-11 > .column:nth-of-type(1n), .large-up-11 > .columns:nth-of-type(1n) {
      clear: none; }
    .large-up-11 > .column:nth-of-type(11n+1), .large-up-11 > .columns:nth-of-type(11n+1) {
      clear: both; }
    .large-up-11 > .column:last-child, .large-up-11 > .columns:last-child {
      float: left; }
  .large-up-12 > .column, .large-up-12 > .columns {
    float: left;
    width: 8.33333%; }
    .large-up-12 > .column:nth-of-type(1n), .large-up-12 > .columns:nth-of-type(1n) {
      clear: none; }
    .large-up-12 > .column:nth-of-type(12n+1), .large-up-12 > .columns:nth-of-type(12n+1) {
      clear: both; }
    .large-up-12 > .column:last-child, .large-up-12 > .columns:last-child {
      float: left; }
  .large-up-13 > .column, .large-up-13 > .columns {
    float: left;
    width: 7.69231%; }
    .large-up-13 > .column:nth-of-type(1n), .large-up-13 > .columns:nth-of-type(1n) {
      clear: none; }
    .large-up-13 > .column:nth-of-type(13n+1), .large-up-13 > .columns:nth-of-type(13n+1) {
      clear: both; }
    .large-up-13 > .column:last-child, .large-up-13 > .columns:last-child {
      float: left; }
  .large-up-14 > .column, .large-up-14 > .columns {
    float: left;
    width: 7.14286%; }
    .large-up-14 > .column:nth-of-type(1n), .large-up-14 > .columns:nth-of-type(1n) {
      clear: none; }
    .large-up-14 > .column:nth-of-type(14n+1), .large-up-14 > .columns:nth-of-type(14n+1) {
      clear: both; }
    .large-up-14 > .column:last-child, .large-up-14 > .columns:last-child {
      float: left; }
  .large-up-15 > .column, .large-up-15 > .columns {
    float: left;
    width: 6.66667%; }
    .large-up-15 > .column:nth-of-type(1n), .large-up-15 > .columns:nth-of-type(1n) {
      clear: none; }
    .large-up-15 > .column:nth-of-type(15n+1), .large-up-15 > .columns:nth-of-type(15n+1) {
      clear: both; }
    .large-up-15 > .column:last-child, .large-up-15 > .columns:last-child {
      float: left; }
  .large-up-16 > .column, .large-up-16 > .columns {
    float: left;
    width: 6.25%; }
    .large-up-16 > .column:nth-of-type(1n), .large-up-16 > .columns:nth-of-type(1n) {
      clear: none; }
    .large-up-16 > .column:nth-of-type(16n+1), .large-up-16 > .columns:nth-of-type(16n+1) {
      clear: both; }
    .large-up-16 > .column:last-child, .large-up-16 > .columns:last-child {
      float: left; }
  .large-collapse > .column, .large-collapse > .columns {
    padding-right: 0;
    padding-left: 0; }
  .large-collapse .row {
    margin-right: 0;
    margin-left: 0; }
  .expanded.row .large-collapse.row {
    margin-right: 0;
    margin-left: 0; }
  .large-uncollapse > .column, .large-uncollapse > .columns {
    padding-right: 0.875rem;
    padding-left: 0.875rem; }
  .large-centered {
    margin-right: auto;
    margin-left: auto; }
    .large-centered, .large-centered:last-child:not(:first-child) {
      float: none;
      clear: both; }
  .large-uncentered, .large-push-0, .large-pull-0 {
    position: static;
    margin-right: 0;
    margin-left: 0; }
    .large-uncentered, .large-uncentered:last-child:not(:first-child), .large-push-0, .large-push-0:last-child:not(:first-child), .large-pull-0, .large-pull-0:last-child:not(:first-child) {
      float: left;
      clear: none; }
    .large-uncentered:last-child:not(:first-child), .large-push-0:last-child:not(:first-child), .large-pull-0:last-child:not(:first-child) {
      float: right; } }

@media screen and (min-width: 80em) {
  .xlarge-1 {
    width: 8.33333%; }
  .xlarge-push-1 {
    position: relative;
    left: 8.33333%; }
  .xlarge-pull-1 {
    position: relative;
    left: -8.33333%; }
  .xlarge-offset-0 {
    margin-left: 0%; }
  .xlarge-2 {
    width: 16.66667%; }
  .xlarge-push-2 {
    position: relative;
    left: 16.66667%; }
  .xlarge-pull-2 {
    position: relative;
    left: -16.66667%; }
  .xlarge-offset-1 {
    margin-left: 8.33333%; }
  .xlarge-3 {
    width: 25%; }
  .xlarge-push-3 {
    position: relative;
    left: 25%; }
  .xlarge-pull-3 {
    position: relative;
    left: -25%; }
  .xlarge-offset-2 {
    margin-left: 16.66667%; }
  .xlarge-4 {
    width: 33.33333%; }
  .xlarge-push-4 {
    position: relative;
    left: 33.33333%; }
  .xlarge-pull-4 {
    position: relative;
    left: -33.33333%; }
  .xlarge-offset-3 {
    margin-left: 25%; }
  .xlarge-5 {
    width: 41.66667%; }
  .xlarge-push-5 {
    position: relative;
    left: 41.66667%; }
  .xlarge-pull-5 {
    position: relative;
    left: -41.66667%; }
  .xlarge-offset-4 {
    margin-left: 33.33333%; }
  .xlarge-6 {
    width: 50%; }
  .xlarge-push-6 {
    position: relative;
    left: 50%; }
  .xlarge-pull-6 {
    position: relative;
    left: -50%; }
  .xlarge-offset-5 {
    margin-left: 41.66667%; }
  .xlarge-7 {
    width: 58.33333%; }
  .xlarge-push-7 {
    position: relative;
    left: 58.33333%; }
  .xlarge-pull-7 {
    position: relative;
    left: -58.33333%; }
  .xlarge-offset-6 {
    margin-left: 50%; }
  .xlarge-8 {
    width: 66.66667%; }
  .xlarge-push-8 {
    position: relative;
    left: 66.66667%; }
  .xlarge-pull-8 {
    position: relative;
    left: -66.66667%; }
  .xlarge-offset-7 {
    margin-left: 58.33333%; }
  .xlarge-9 {
    width: 75%; }
  .xlarge-push-9 {
    position: relative;
    left: 75%; }
  .xlarge-pull-9 {
    position: relative;
    left: -75%; }
  .xlarge-offset-8 {
    margin-left: 66.66667%; }
  .xlarge-10 {
    width: 83.33333%; }
  .xlarge-push-10 {
    position: relative;
    left: 83.33333%; }
  .xlarge-pull-10 {
    position: relative;
    left: -83.33333%; }
  .xlarge-offset-9 {
    margin-left: 75%; }
  .xlarge-11 {
    width: 91.66667%; }
  .xlarge-push-11 {
    position: relative;
    left: 91.66667%; }
  .xlarge-pull-11 {
    position: relative;
    left: -91.66667%; }
  .xlarge-offset-10 {
    margin-left: 83.33333%; }
  .xlarge-12 {
    width: 100%; }
  .xlarge-offset-11 {
    margin-left: 91.66667%; }
  .xlarge-up-1 > .column, .xlarge-up-1 > .columns {
    float: left;
    width: 100%; }
    .xlarge-up-1 > .column:nth-of-type(1n), .xlarge-up-1 > .columns:nth-of-type(1n) {
      clear: none; }
    .xlarge-up-1 > .column:nth-of-type(1n+1), .xlarge-up-1 > .columns:nth-of-type(1n+1) {
      clear: both; }
    .xlarge-up-1 > .column:last-child, .xlarge-up-1 > .columns:last-child {
      float: left; }
  .xlarge-up-2 > .column, .xlarge-up-2 > .columns {
    float: left;
    width: 50%; }
    .xlarge-up-2 > .column:nth-of-type(1n), .xlarge-up-2 > .columns:nth-of-type(1n) {
      clear: none; }
    .xlarge-up-2 > .column:nth-of-type(2n+1), .xlarge-up-2 > .columns:nth-of-type(2n+1) {
      clear: both; }
    .xlarge-up-2 > .column:last-child, .xlarge-up-2 > .columns:last-child {
      float: left; }
  .xlarge-up-3 > .column, .xlarge-up-3 > .columns {
    float: left;
    width: 33.33333%; }
    .xlarge-up-3 > .column:nth-of-type(1n), .xlarge-up-3 > .columns:nth-of-type(1n) {
      clear: none; }
    .xlarge-up-3 > .column:nth-of-type(3n+1), .xlarge-up-3 > .columns:nth-of-type(3n+1) {
      clear: both; }
    .xlarge-up-3 > .column:last-child, .xlarge-up-3 > .columns:last-child {
      float: left; }
  .xlarge-up-4 > .column, .xlarge-up-4 > .columns {
    float: left;
    width: 25%; }
    .xlarge-up-4 > .column:nth-of-type(1n), .xlarge-up-4 > .columns:nth-of-type(1n) {
      clear: none; }
    .xlarge-up-4 > .column:nth-of-type(4n+1), .xlarge-up-4 > .columns:nth-of-type(4n+1) {
      clear: both; }
    .xlarge-up-4 > .column:last-child, .xlarge-up-4 > .columns:last-child {
      float: left; }
  .xlarge-up-5 > .column, .xlarge-up-5 > .columns {
    float: left;
    width: 20%; }
    .xlarge-up-5 > .column:nth-of-type(1n), .xlarge-up-5 > .columns:nth-of-type(1n) {
      clear: none; }
    .xlarge-up-5 > .column:nth-of-type(5n+1), .xlarge-up-5 > .columns:nth-of-type(5n+1) {
      clear: both; }
    .xlarge-up-5 > .column:last-child, .xlarge-up-5 > .columns:last-child {
      float: left; }
  .xlarge-up-6 > .column, .xlarge-up-6 > .columns {
    float: left;
    width: 16.66667%; }
    .xlarge-up-6 > .column:nth-of-type(1n), .xlarge-up-6 > .columns:nth-of-type(1n) {
      clear: none; }
    .xlarge-up-6 > .column:nth-of-type(6n+1), .xlarge-up-6 > .columns:nth-of-type(6n+1) {
      clear: both; }
    .xlarge-up-6 > .column:last-child, .xlarge-up-6 > .columns:last-child {
      float: left; }
  .xlarge-up-7 > .column, .xlarge-up-7 > .columns {
    float: left;
    width: 14.28571%; }
    .xlarge-up-7 > .column:nth-of-type(1n), .xlarge-up-7 > .columns:nth-of-type(1n) {
      clear: none; }
    .xlarge-up-7 > .column:nth-of-type(7n+1), .xlarge-up-7 > .columns:nth-of-type(7n+1) {
      clear: both; }
    .xlarge-up-7 > .column:last-child, .xlarge-up-7 > .columns:last-child {
      float: left; }
  .xlarge-up-8 > .column, .xlarge-up-8 > .columns {
    float: left;
    width: 12.5%; }
    .xlarge-up-8 > .column:nth-of-type(1n), .xlarge-up-8 > .columns:nth-of-type(1n) {
      clear: none; }
    .xlarge-up-8 > .column:nth-of-type(8n+1), .xlarge-up-8 > .columns:nth-of-type(8n+1) {
      clear: both; }
    .xlarge-up-8 > .column:last-child, .xlarge-up-8 > .columns:last-child {
      float: left; }
  .xlarge-up-9 > .column, .xlarge-up-9 > .columns {
    float: left;
    width: 11.11111%; }
    .xlarge-up-9 > .column:nth-of-type(1n), .xlarge-up-9 > .columns:nth-of-type(1n) {
      clear: none; }
    .xlarge-up-9 > .column:nth-of-type(9n+1), .xlarge-up-9 > .columns:nth-of-type(9n+1) {
      clear: both; }
    .xlarge-up-9 > .column:last-child, .xlarge-up-9 > .columns:last-child {
      float: left; }
  .xlarge-up-10 > .column, .xlarge-up-10 > .columns {
    float: left;
    width: 10%; }
    .xlarge-up-10 > .column:nth-of-type(1n), .xlarge-up-10 > .columns:nth-of-type(1n) {
      clear: none; }
    .xlarge-up-10 > .column:nth-of-type(10n+1), .xlarge-up-10 > .columns:nth-of-type(10n+1) {
      clear: both; }
    .xlarge-up-10 > .column:last-child, .xlarge-up-10 > .columns:last-child {
      float: left; }
  .xlarge-up-11 > .column, .xlarge-up-11 > .columns {
    float: left;
    width: 9.09091%; }
    .xlarge-up-11 > .column:nth-of-type(1n), .xlarge-up-11 > .columns:nth-of-type(1n) {
      clear: none; }
    .xlarge-up-11 > .column:nth-of-type(11n+1), .xlarge-up-11 > .columns:nth-of-type(11n+1) {
      clear: both; }
    .xlarge-up-11 > .column:last-child, .xlarge-up-11 > .columns:last-child {
      float: left; }
  .xlarge-up-12 > .column, .xlarge-up-12 > .columns {
    float: left;
    width: 8.33333%; }
    .xlarge-up-12 > .column:nth-of-type(1n), .xlarge-up-12 > .columns:nth-of-type(1n) {
      clear: none; }
    .xlarge-up-12 > .column:nth-of-type(12n+1), .xlarge-up-12 > .columns:nth-of-type(12n+1) {
      clear: both; }
    .xlarge-up-12 > .column:last-child, .xlarge-up-12 > .columns:last-child {
      float: left; }
  .xlarge-up-13 > .column, .xlarge-up-13 > .columns {
    float: left;
    width: 7.69231%; }
    .xlarge-up-13 > .column:nth-of-type(1n), .xlarge-up-13 > .columns:nth-of-type(1n) {
      clear: none; }
    .xlarge-up-13 > .column:nth-of-type(13n+1), .xlarge-up-13 > .columns:nth-of-type(13n+1) {
      clear: both; }
    .xlarge-up-13 > .column:last-child, .xlarge-up-13 > .columns:last-child {
      float: left; }
  .xlarge-up-14 > .column, .xlarge-up-14 > .columns {
    float: left;
    width: 7.14286%; }
    .xlarge-up-14 > .column:nth-of-type(1n), .xlarge-up-14 > .columns:nth-of-type(1n) {
      clear: none; }
    .xlarge-up-14 > .column:nth-of-type(14n+1), .xlarge-up-14 > .columns:nth-of-type(14n+1) {
      clear: both; }
    .xlarge-up-14 > .column:last-child, .xlarge-up-14 > .columns:last-child {
      float: left; }
  .xlarge-up-15 > .column, .xlarge-up-15 > .columns {
    float: left;
    width: 6.66667%; }
    .xlarge-up-15 > .column:nth-of-type(1n), .xlarge-up-15 > .columns:nth-of-type(1n) {
      clear: none; }
    .xlarge-up-15 > .column:nth-of-type(15n+1), .xlarge-up-15 > .columns:nth-of-type(15n+1) {
      clear: both; }
    .xlarge-up-15 > .column:last-child, .xlarge-up-15 > .columns:last-child {
      float: left; }
  .xlarge-up-16 > .column, .xlarge-up-16 > .columns {
    float: left;
    width: 6.25%; }
    .xlarge-up-16 > .column:nth-of-type(1n), .xlarge-up-16 > .columns:nth-of-type(1n) {
      clear: none; }
    .xlarge-up-16 > .column:nth-of-type(16n+1), .xlarge-up-16 > .columns:nth-of-type(16n+1) {
      clear: both; }
    .xlarge-up-16 > .column:last-child, .xlarge-up-16 > .columns:last-child {
      float: left; }
  .xlarge-collapse > .column, .xlarge-collapse > .columns {
    padding-right: 0;
    padding-left: 0; }
  .xlarge-collapse .row {
    margin-right: 0;
    margin-left: 0; }
  .expanded.row .xlarge-collapse.row {
    margin-right: 0;
    margin-left: 0; }
  .xlarge-uncollapse > .column, .xlarge-uncollapse > .columns {
    padding-right: 0.875rem;
    padding-left: 0.875rem; }
  .xlarge-centered {
    margin-right: auto;
    margin-left: auto; }
    .xlarge-centered, .xlarge-centered:last-child:not(:first-child) {
      float: none;
      clear: both; }
  .xlarge-uncentered, .xlarge-push-0, .xlarge-pull-0 {
    position: static;
    margin-right: 0;
    margin-left: 0; }
    .xlarge-uncentered, .xlarge-uncentered:last-child:not(:first-child), .xlarge-push-0, .xlarge-push-0:last-child:not(:first-child), .xlarge-pull-0, .xlarge-pull-0:last-child:not(:first-child) {
      float: left;
      clear: none; }
    .xlarge-uncentered:last-child:not(:first-child), .xlarge-push-0:last-child:not(:first-child), .xlarge-pull-0:last-child:not(:first-child) {
      float: right; } }

@media screen and (min-width: 100em) {
  .xxlarge-1 {
    width: 8.33333%; }
  .xxlarge-push-1 {
    position: relative;
    left: 8.33333%; }
  .xxlarge-pull-1 {
    position: relative;
    left: -8.33333%; }
  .xxlarge-offset-0 {
    margin-left: 0%; }
  .xxlarge-2 {
    width: 16.66667%; }
  .xxlarge-push-2 {
    position: relative;
    left: 16.66667%; }
  .xxlarge-pull-2 {
    position: relative;
    left: -16.66667%; }
  .xxlarge-offset-1 {
    margin-left: 8.33333%; }
  .xxlarge-3 {
    width: 25%; }
  .xxlarge-push-3 {
    position: relative;
    left: 25%; }
  .xxlarge-pull-3 {
    position: relative;
    left: -25%; }
  .xxlarge-offset-2 {
    margin-left: 16.66667%; }
  .xxlarge-4 {
    width: 33.33333%; }
  .xxlarge-push-4 {
    position: relative;
    left: 33.33333%; }
  .xxlarge-pull-4 {
    position: relative;
    left: -33.33333%; }
  .xxlarge-offset-3 {
    margin-left: 25%; }
  .xxlarge-5 {
    width: 41.66667%; }
  .xxlarge-push-5 {
    position: relative;
    left: 41.66667%; }
  .xxlarge-pull-5 {
    position: relative;
    left: -41.66667%; }
  .xxlarge-offset-4 {
    margin-left: 33.33333%; }
  .xxlarge-6 {
    width: 50%; }
  .xxlarge-push-6 {
    position: relative;
    left: 50%; }
  .xxlarge-pull-6 {
    position: relative;
    left: -50%; }
  .xxlarge-offset-5 {
    margin-left: 41.66667%; }
  .xxlarge-7 {
    width: 58.33333%; }
  .xxlarge-push-7 {
    position: relative;
    left: 58.33333%; }
  .xxlarge-pull-7 {
    position: relative;
    left: -58.33333%; }
  .xxlarge-offset-6 {
    margin-left: 50%; }
  .xxlarge-8 {
    width: 66.66667%; }
  .xxlarge-push-8 {
    position: relative;
    left: 66.66667%; }
  .xxlarge-pull-8 {
    position: relative;
    left: -66.66667%; }
  .xxlarge-offset-7 {
    margin-left: 58.33333%; }
  .xxlarge-9 {
    width: 75%; }
  .xxlarge-push-9 {
    position: relative;
    left: 75%; }
  .xxlarge-pull-9 {
    position: relative;
    left: -75%; }
  .xxlarge-offset-8 {
    margin-left: 66.66667%; }
  .xxlarge-10 {
    width: 83.33333%; }
  .xxlarge-push-10 {
    position: relative;
    left: 83.33333%; }
  .xxlarge-pull-10 {
    position: relative;
    left: -83.33333%; }
  .xxlarge-offset-9 {
    margin-left: 75%; }
  .xxlarge-11 {
    width: 91.66667%; }
  .xxlarge-push-11 {
    position: relative;
    left: 91.66667%; }
  .xxlarge-pull-11 {
    position: relative;
    left: -91.66667%; }
  .xxlarge-offset-10 {
    margin-left: 83.33333%; }
  .xxlarge-12 {
    width: 100%; }
  .xxlarge-offset-11 {
    margin-left: 91.66667%; }
  .xxlarge-up-1 > .column, .xxlarge-up-1 > .columns {
    float: left;
    width: 100%; }
    .xxlarge-up-1 > .column:nth-of-type(1n), .xxlarge-up-1 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxlarge-up-1 > .column:nth-of-type(1n+1), .xxlarge-up-1 > .columns:nth-of-type(1n+1) {
      clear: both; }
    .xxlarge-up-1 > .column:last-child, .xxlarge-up-1 > .columns:last-child {
      float: left; }
  .xxlarge-up-2 > .column, .xxlarge-up-2 > .columns {
    float: left;
    width: 50%; }
    .xxlarge-up-2 > .column:nth-of-type(1n), .xxlarge-up-2 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxlarge-up-2 > .column:nth-of-type(2n+1), .xxlarge-up-2 > .columns:nth-of-type(2n+1) {
      clear: both; }
    .xxlarge-up-2 > .column:last-child, .xxlarge-up-2 > .columns:last-child {
      float: left; }
  .xxlarge-up-3 > .column, .xxlarge-up-3 > .columns {
    float: left;
    width: 33.33333%; }
    .xxlarge-up-3 > .column:nth-of-type(1n), .xxlarge-up-3 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxlarge-up-3 > .column:nth-of-type(3n+1), .xxlarge-up-3 > .columns:nth-of-type(3n+1) {
      clear: both; }
    .xxlarge-up-3 > .column:last-child, .xxlarge-up-3 > .columns:last-child {
      float: left; }
  .xxlarge-up-4 > .column, .xxlarge-up-4 > .columns {
    float: left;
    width: 25%; }
    .xxlarge-up-4 > .column:nth-of-type(1n), .xxlarge-up-4 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxlarge-up-4 > .column:nth-of-type(4n+1), .xxlarge-up-4 > .columns:nth-of-type(4n+1) {
      clear: both; }
    .xxlarge-up-4 > .column:last-child, .xxlarge-up-4 > .columns:last-child {
      float: left; }
  .xxlarge-up-5 > .column, .xxlarge-up-5 > .columns {
    float: left;
    width: 20%; }
    .xxlarge-up-5 > .column:nth-of-type(1n), .xxlarge-up-5 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxlarge-up-5 > .column:nth-of-type(5n+1), .xxlarge-up-5 > .columns:nth-of-type(5n+1) {
      clear: both; }
    .xxlarge-up-5 > .column:last-child, .xxlarge-up-5 > .columns:last-child {
      float: left; }
  .xxlarge-up-6 > .column, .xxlarge-up-6 > .columns {
    float: left;
    width: 16.66667%; }
    .xxlarge-up-6 > .column:nth-of-type(1n), .xxlarge-up-6 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxlarge-up-6 > .column:nth-of-type(6n+1), .xxlarge-up-6 > .columns:nth-of-type(6n+1) {
      clear: both; }
    .xxlarge-up-6 > .column:last-child, .xxlarge-up-6 > .columns:last-child {
      float: left; }
  .xxlarge-up-7 > .column, .xxlarge-up-7 > .columns {
    float: left;
    width: 14.28571%; }
    .xxlarge-up-7 > .column:nth-of-type(1n), .xxlarge-up-7 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxlarge-up-7 > .column:nth-of-type(7n+1), .xxlarge-up-7 > .columns:nth-of-type(7n+1) {
      clear: both; }
    .xxlarge-up-7 > .column:last-child, .xxlarge-up-7 > .columns:last-child {
      float: left; }
  .xxlarge-up-8 > .column, .xxlarge-up-8 > .columns {
    float: left;
    width: 12.5%; }
    .xxlarge-up-8 > .column:nth-of-type(1n), .xxlarge-up-8 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxlarge-up-8 > .column:nth-of-type(8n+1), .xxlarge-up-8 > .columns:nth-of-type(8n+1) {
      clear: both; }
    .xxlarge-up-8 > .column:last-child, .xxlarge-up-8 > .columns:last-child {
      float: left; }
  .xxlarge-up-9 > .column, .xxlarge-up-9 > .columns {
    float: left;
    width: 11.11111%; }
    .xxlarge-up-9 > .column:nth-of-type(1n), .xxlarge-up-9 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxlarge-up-9 > .column:nth-of-type(9n+1), .xxlarge-up-9 > .columns:nth-of-type(9n+1) {
      clear: both; }
    .xxlarge-up-9 > .column:last-child, .xxlarge-up-9 > .columns:last-child {
      float: left; }
  .xxlarge-up-10 > .column, .xxlarge-up-10 > .columns {
    float: left;
    width: 10%; }
    .xxlarge-up-10 > .column:nth-of-type(1n), .xxlarge-up-10 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxlarge-up-10 > .column:nth-of-type(10n+1), .xxlarge-up-10 > .columns:nth-of-type(10n+1) {
      clear: both; }
    .xxlarge-up-10 > .column:last-child, .xxlarge-up-10 > .columns:last-child {
      float: left; }
  .xxlarge-up-11 > .column, .xxlarge-up-11 > .columns {
    float: left;
    width: 9.09091%; }
    .xxlarge-up-11 > .column:nth-of-type(1n), .xxlarge-up-11 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxlarge-up-11 > .column:nth-of-type(11n+1), .xxlarge-up-11 > .columns:nth-of-type(11n+1) {
      clear: both; }
    .xxlarge-up-11 > .column:last-child, .xxlarge-up-11 > .columns:last-child {
      float: left; }
  .xxlarge-up-12 > .column, .xxlarge-up-12 > .columns {
    float: left;
    width: 8.33333%; }
    .xxlarge-up-12 > .column:nth-of-type(1n), .xxlarge-up-12 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxlarge-up-12 > .column:nth-of-type(12n+1), .xxlarge-up-12 > .columns:nth-of-type(12n+1) {
      clear: both; }
    .xxlarge-up-12 > .column:last-child, .xxlarge-up-12 > .columns:last-child {
      float: left; }
  .xxlarge-up-13 > .column, .xxlarge-up-13 > .columns {
    float: left;
    width: 7.69231%; }
    .xxlarge-up-13 > .column:nth-of-type(1n), .xxlarge-up-13 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxlarge-up-13 > .column:nth-of-type(13n+1), .xxlarge-up-13 > .columns:nth-of-type(13n+1) {
      clear: both; }
    .xxlarge-up-13 > .column:last-child, .xxlarge-up-13 > .columns:last-child {
      float: left; }
  .xxlarge-up-14 > .column, .xxlarge-up-14 > .columns {
    float: left;
    width: 7.14286%; }
    .xxlarge-up-14 > .column:nth-of-type(1n), .xxlarge-up-14 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxlarge-up-14 > .column:nth-of-type(14n+1), .xxlarge-up-14 > .columns:nth-of-type(14n+1) {
      clear: both; }
    .xxlarge-up-14 > .column:last-child, .xxlarge-up-14 > .columns:last-child {
      float: left; }
  .xxlarge-up-15 > .column, .xxlarge-up-15 > .columns {
    float: left;
    width: 6.66667%; }
    .xxlarge-up-15 > .column:nth-of-type(1n), .xxlarge-up-15 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxlarge-up-15 > .column:nth-of-type(15n+1), .xxlarge-up-15 > .columns:nth-of-type(15n+1) {
      clear: both; }
    .xxlarge-up-15 > .column:last-child, .xxlarge-up-15 > .columns:last-child {
      float: left; }
  .xxlarge-up-16 > .column, .xxlarge-up-16 > .columns {
    float: left;
    width: 6.25%; }
    .xxlarge-up-16 > .column:nth-of-type(1n), .xxlarge-up-16 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxlarge-up-16 > .column:nth-of-type(16n+1), .xxlarge-up-16 > .columns:nth-of-type(16n+1) {
      clear: both; }
    .xxlarge-up-16 > .column:last-child, .xxlarge-up-16 > .columns:last-child {
      float: left; }
  .xxlarge-collapse > .column, .xxlarge-collapse > .columns {
    padding-right: 0;
    padding-left: 0; }
  .xxlarge-collapse .row {
    margin-right: 0;
    margin-left: 0; }
  .expanded.row .xxlarge-collapse.row {
    margin-right: 0;
    margin-left: 0; }
  .xxlarge-uncollapse > .column, .xxlarge-uncollapse > .columns {
    padding-right: 0.875rem;
    padding-left: 0.875rem; }
  .xxlarge-centered {
    margin-right: auto;
    margin-left: auto; }
    .xxlarge-centered, .xxlarge-centered:last-child:not(:first-child) {
      float: none;
      clear: both; }
  .xxlarge-uncentered, .xxlarge-push-0, .xxlarge-pull-0 {
    position: static;
    margin-right: 0;
    margin-left: 0; }
    .xxlarge-uncentered, .xxlarge-uncentered:last-child:not(:first-child), .xxlarge-push-0, .xxlarge-push-0:last-child:not(:first-child), .xxlarge-pull-0, .xxlarge-pull-0:last-child:not(:first-child) {
      float: left;
      clear: none; }
    .xxlarge-uncentered:last-child:not(:first-child), .xxlarge-push-0:last-child:not(:first-child), .xxlarge-pull-0:last-child:not(:first-child) {
      float: right; } }

@media screen and (min-width: 120em) {
  .xxxlarge-1 {
    width: 8.33333%; }
  .xxxlarge-push-1 {
    position: relative;
    left: 8.33333%; }
  .xxxlarge-pull-1 {
    position: relative;
    left: -8.33333%; }
  .xxxlarge-offset-0 {
    margin-left: 0%; }
  .xxxlarge-2 {
    width: 16.66667%; }
  .xxxlarge-push-2 {
    position: relative;
    left: 16.66667%; }
  .xxxlarge-pull-2 {
    position: relative;
    left: -16.66667%; }
  .xxxlarge-offset-1 {
    margin-left: 8.33333%; }
  .xxxlarge-3 {
    width: 25%; }
  .xxxlarge-push-3 {
    position: relative;
    left: 25%; }
  .xxxlarge-pull-3 {
    position: relative;
    left: -25%; }
  .xxxlarge-offset-2 {
    margin-left: 16.66667%; }
  .xxxlarge-4 {
    width: 33.33333%; }
  .xxxlarge-push-4 {
    position: relative;
    left: 33.33333%; }
  .xxxlarge-pull-4 {
    position: relative;
    left: -33.33333%; }
  .xxxlarge-offset-3 {
    margin-left: 25%; }
  .xxxlarge-5 {
    width: 41.66667%; }
  .xxxlarge-push-5 {
    position: relative;
    left: 41.66667%; }
  .xxxlarge-pull-5 {
    position: relative;
    left: -41.66667%; }
  .xxxlarge-offset-4 {
    margin-left: 33.33333%; }
  .xxxlarge-6 {
    width: 50%; }
  .xxxlarge-push-6 {
    position: relative;
    left: 50%; }
  .xxxlarge-pull-6 {
    position: relative;
    left: -50%; }
  .xxxlarge-offset-5 {
    margin-left: 41.66667%; }
  .xxxlarge-7 {
    width: 58.33333%; }
  .xxxlarge-push-7 {
    position: relative;
    left: 58.33333%; }
  .xxxlarge-pull-7 {
    position: relative;
    left: -58.33333%; }
  .xxxlarge-offset-6 {
    margin-left: 50%; }
  .xxxlarge-8 {
    width: 66.66667%; }
  .xxxlarge-push-8 {
    position: relative;
    left: 66.66667%; }
  .xxxlarge-pull-8 {
    position: relative;
    left: -66.66667%; }
  .xxxlarge-offset-7 {
    margin-left: 58.33333%; }
  .xxxlarge-9 {
    width: 75%; }
  .xxxlarge-push-9 {
    position: relative;
    left: 75%; }
  .xxxlarge-pull-9 {
    position: relative;
    left: -75%; }
  .xxxlarge-offset-8 {
    margin-left: 66.66667%; }
  .xxxlarge-10 {
    width: 83.33333%; }
  .xxxlarge-push-10 {
    position: relative;
    left: 83.33333%; }
  .xxxlarge-pull-10 {
    position: relative;
    left: -83.33333%; }
  .xxxlarge-offset-9 {
    margin-left: 75%; }
  .xxxlarge-11 {
    width: 91.66667%; }
  .xxxlarge-push-11 {
    position: relative;
    left: 91.66667%; }
  .xxxlarge-pull-11 {
    position: relative;
    left: -91.66667%; }
  .xxxlarge-offset-10 {
    margin-left: 83.33333%; }
  .xxxlarge-12 {
    width: 100%; }
  .xxxlarge-offset-11 {
    margin-left: 91.66667%; }
  .xxxlarge-up-1 > .column, .xxxlarge-up-1 > .columns {
    float: left;
    width: 100%; }
    .xxxlarge-up-1 > .column:nth-of-type(1n), .xxxlarge-up-1 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxxlarge-up-1 > .column:nth-of-type(1n+1), .xxxlarge-up-1 > .columns:nth-of-type(1n+1) {
      clear: both; }
    .xxxlarge-up-1 > .column:last-child, .xxxlarge-up-1 > .columns:last-child {
      float: left; }
  .xxxlarge-up-2 > .column, .xxxlarge-up-2 > .columns {
    float: left;
    width: 50%; }
    .xxxlarge-up-2 > .column:nth-of-type(1n), .xxxlarge-up-2 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxxlarge-up-2 > .column:nth-of-type(2n+1), .xxxlarge-up-2 > .columns:nth-of-type(2n+1) {
      clear: both; }
    .xxxlarge-up-2 > .column:last-child, .xxxlarge-up-2 > .columns:last-child {
      float: left; }
  .xxxlarge-up-3 > .column, .xxxlarge-up-3 > .columns {
    float: left;
    width: 33.33333%; }
    .xxxlarge-up-3 > .column:nth-of-type(1n), .xxxlarge-up-3 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxxlarge-up-3 > .column:nth-of-type(3n+1), .xxxlarge-up-3 > .columns:nth-of-type(3n+1) {
      clear: both; }
    .xxxlarge-up-3 > .column:last-child, .xxxlarge-up-3 > .columns:last-child {
      float: left; }
  .xxxlarge-up-4 > .column, .xxxlarge-up-4 > .columns {
    float: left;
    width: 25%; }
    .xxxlarge-up-4 > .column:nth-of-type(1n), .xxxlarge-up-4 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxxlarge-up-4 > .column:nth-of-type(4n+1), .xxxlarge-up-4 > .columns:nth-of-type(4n+1) {
      clear: both; }
    .xxxlarge-up-4 > .column:last-child, .xxxlarge-up-4 > .columns:last-child {
      float: left; }
  .xxxlarge-up-5 > .column, .xxxlarge-up-5 > .columns {
    float: left;
    width: 20%; }
    .xxxlarge-up-5 > .column:nth-of-type(1n), .xxxlarge-up-5 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxxlarge-up-5 > .column:nth-of-type(5n+1), .xxxlarge-up-5 > .columns:nth-of-type(5n+1) {
      clear: both; }
    .xxxlarge-up-5 > .column:last-child, .xxxlarge-up-5 > .columns:last-child {
      float: left; }
  .xxxlarge-up-6 > .column, .xxxlarge-up-6 > .columns {
    float: left;
    width: 16.66667%; }
    .xxxlarge-up-6 > .column:nth-of-type(1n), .xxxlarge-up-6 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxxlarge-up-6 > .column:nth-of-type(6n+1), .xxxlarge-up-6 > .columns:nth-of-type(6n+1) {
      clear: both; }
    .xxxlarge-up-6 > .column:last-child, .xxxlarge-up-6 > .columns:last-child {
      float: left; }
  .xxxlarge-up-7 > .column, .xxxlarge-up-7 > .columns {
    float: left;
    width: 14.28571%; }
    .xxxlarge-up-7 > .column:nth-of-type(1n), .xxxlarge-up-7 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxxlarge-up-7 > .column:nth-of-type(7n+1), .xxxlarge-up-7 > .columns:nth-of-type(7n+1) {
      clear: both; }
    .xxxlarge-up-7 > .column:last-child, .xxxlarge-up-7 > .columns:last-child {
      float: left; }
  .xxxlarge-up-8 > .column, .xxxlarge-up-8 > .columns {
    float: left;
    width: 12.5%; }
    .xxxlarge-up-8 > .column:nth-of-type(1n), .xxxlarge-up-8 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxxlarge-up-8 > .column:nth-of-type(8n+1), .xxxlarge-up-8 > .columns:nth-of-type(8n+1) {
      clear: both; }
    .xxxlarge-up-8 > .column:last-child, .xxxlarge-up-8 > .columns:last-child {
      float: left; }
  .xxxlarge-up-9 > .column, .xxxlarge-up-9 > .columns {
    float: left;
    width: 11.11111%; }
    .xxxlarge-up-9 > .column:nth-of-type(1n), .xxxlarge-up-9 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxxlarge-up-9 > .column:nth-of-type(9n+1), .xxxlarge-up-9 > .columns:nth-of-type(9n+1) {
      clear: both; }
    .xxxlarge-up-9 > .column:last-child, .xxxlarge-up-9 > .columns:last-child {
      float: left; }
  .xxxlarge-up-10 > .column, .xxxlarge-up-10 > .columns {
    float: left;
    width: 10%; }
    .xxxlarge-up-10 > .column:nth-of-type(1n), .xxxlarge-up-10 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxxlarge-up-10 > .column:nth-of-type(10n+1), .xxxlarge-up-10 > .columns:nth-of-type(10n+1) {
      clear: both; }
    .xxxlarge-up-10 > .column:last-child, .xxxlarge-up-10 > .columns:last-child {
      float: left; }
  .xxxlarge-up-11 > .column, .xxxlarge-up-11 > .columns {
    float: left;
    width: 9.09091%; }
    .xxxlarge-up-11 > .column:nth-of-type(1n), .xxxlarge-up-11 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxxlarge-up-11 > .column:nth-of-type(11n+1), .xxxlarge-up-11 > .columns:nth-of-type(11n+1) {
      clear: both; }
    .xxxlarge-up-11 > .column:last-child, .xxxlarge-up-11 > .columns:last-child {
      float: left; }
  .xxxlarge-up-12 > .column, .xxxlarge-up-12 > .columns {
    float: left;
    width: 8.33333%; }
    .xxxlarge-up-12 > .column:nth-of-type(1n), .xxxlarge-up-12 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxxlarge-up-12 > .column:nth-of-type(12n+1), .xxxlarge-up-12 > .columns:nth-of-type(12n+1) {
      clear: both; }
    .xxxlarge-up-12 > .column:last-child, .xxxlarge-up-12 > .columns:last-child {
      float: left; }
  .xxxlarge-up-13 > .column, .xxxlarge-up-13 > .columns {
    float: left;
    width: 7.69231%; }
    .xxxlarge-up-13 > .column:nth-of-type(1n), .xxxlarge-up-13 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxxlarge-up-13 > .column:nth-of-type(13n+1), .xxxlarge-up-13 > .columns:nth-of-type(13n+1) {
      clear: both; }
    .xxxlarge-up-13 > .column:last-child, .xxxlarge-up-13 > .columns:last-child {
      float: left; }
  .xxxlarge-up-14 > .column, .xxxlarge-up-14 > .columns {
    float: left;
    width: 7.14286%; }
    .xxxlarge-up-14 > .column:nth-of-type(1n), .xxxlarge-up-14 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxxlarge-up-14 > .column:nth-of-type(14n+1), .xxxlarge-up-14 > .columns:nth-of-type(14n+1) {
      clear: both; }
    .xxxlarge-up-14 > .column:last-child, .xxxlarge-up-14 > .columns:last-child {
      float: left; }
  .xxxlarge-up-15 > .column, .xxxlarge-up-15 > .columns {
    float: left;
    width: 6.66667%; }
    .xxxlarge-up-15 > .column:nth-of-type(1n), .xxxlarge-up-15 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxxlarge-up-15 > .column:nth-of-type(15n+1), .xxxlarge-up-15 > .columns:nth-of-type(15n+1) {
      clear: both; }
    .xxxlarge-up-15 > .column:last-child, .xxxlarge-up-15 > .columns:last-child {
      float: left; }
  .xxxlarge-up-16 > .column, .xxxlarge-up-16 > .columns {
    float: left;
    width: 6.25%; }
    .xxxlarge-up-16 > .column:nth-of-type(1n), .xxxlarge-up-16 > .columns:nth-of-type(1n) {
      clear: none; }
    .xxxlarge-up-16 > .column:nth-of-type(16n+1), .xxxlarge-up-16 > .columns:nth-of-type(16n+1) {
      clear: both; }
    .xxxlarge-up-16 > .column:last-child, .xxxlarge-up-16 > .columns:last-child {
      float: left; }
  .xxxlarge-collapse > .column, .xxxlarge-collapse > .columns {
    padding-right: 0;
    padding-left: 0; }
  .xxxlarge-collapse .row {
    margin-right: 0;
    margin-left: 0; }
  .expanded.row .xxxlarge-collapse.row {
    margin-right: 0;
    margin-left: 0; }
  .xxxlarge-uncollapse > .column, .xxxlarge-uncollapse > .columns {
    padding-right: 0.875rem;
    padding-left: 0.875rem; }
  .xxxlarge-centered {
    margin-right: auto;
    margin-left: auto; }
    .xxxlarge-centered, .xxxlarge-centered:last-child:not(:first-child) {
      float: none;
      clear: both; }
  .xxxlarge-uncentered, .xxxlarge-push-0, .xxxlarge-pull-0 {
    position: static;
    margin-right: 0;
    margin-left: 0; }
    .xxxlarge-uncentered, .xxxlarge-uncentered:last-child:not(:first-child), .xxxlarge-push-0, .xxxlarge-push-0:last-child:not(:first-child), .xxxlarge-pull-0, .xxxlarge-pull-0:last-child:not(:first-child) {
      float: left;
      clear: none; }
    .xxxlarge-uncentered:last-child:not(:first-child), .xxxlarge-push-0:last-child:not(:first-child), .xxxlarge-pull-0:last-child:not(:first-child) {
      float: right; } }

.column-block {
  margin-bottom: 1.75rem; }
  .column-block > :last-child {
    margin-bottom: 0; }
  @media print, screen and (min-width: 40em) {
    .column-block {
      margin-bottom: 1.75rem; }
      .column-block > :last-child {
        margin-bottom: 0; } }

.grid-container {
  padding-right: 0.875rem;
  padding-left: 0.875rem;
  max-width: 75rem;
  margin-left: auto;
  margin-right: auto; }
  @media print, screen and (min-width: 40em) {
    .grid-container {
      padding-right: 0.875rem;
      padding-left: 0.875rem; } }
  .grid-container.fluid {
    padding-right: 0.875rem;
    padding-left: 0.875rem;
    max-width: 100%;
    margin-left: auto;
    margin-right: auto; }
    @media print, screen and (min-width: 40em) {
      .grid-container.fluid {
        padding-right: 0.875rem;
        padding-left: 0.875rem; } }
  .grid-container.full {
    padding-right: 0;
    padding-left: 0;
    max-width: 100%;
    margin-left: auto;
    margin-right: auto; }

.grid-x {
  display: -ms-flexbox;
  display: flex;
  -ms-flex-flow: row wrap;
      flex-flow: row wrap; }

.cell {
  -ms-flex: 0 0 auto;
      flex: 0 0 auto;
  min-height: 0px;
  min-width: 0px;
  width: 100%; }
  .cell.auto {
    -ms-flex: 1 1 0px;
        flex: 1 1 0px; }
  .cell.shrink {
    -ms-flex: 0 0 auto;
        flex: 0 0 auto; }

.grid-x > .auto {
  width: auto; }

.grid-x > .shrink {
  width: auto; }

.grid-x > .small-shrink, .grid-x > .small-full, .grid-x > .small-1, .grid-x > .small-2, .grid-x > .small-3, .grid-x > .small-4, .grid-x > .small-5, .grid-x > .small-6, .grid-x > .small-7, .grid-x > .small-8, .grid-x > .small-9, .grid-x > .small-10, .grid-x > .small-11, .grid-x > .small-12 {
  -ms-flex-preferred-size: auto;
      flex-basis: auto; }

@media print, screen and (min-width: 40em) {
  .grid-x > .medium-shrink, .grid-x > .medium-full, .grid-x > .medium-1, .grid-x > .medium-2, .grid-x > .medium-3, .grid-x > .medium-4, .grid-x > .medium-5, .grid-x > .medium-6, .grid-x > .medium-7, .grid-x > .medium-8, .grid-x > .medium-9, .grid-x > .medium-10, .grid-x > .medium-11, .grid-x > .medium-12 {
    -ms-flex-preferred-size: auto;
        flex-basis: auto; } }

@media print, screen and (min-width: 60em) {
  .grid-x > .large-shrink, .grid-x > .large-full, .grid-x > .large-1, .grid-x > .large-2, .grid-x > .large-3, .grid-x > .large-4, .grid-x > .large-5, .grid-x > .large-6, .grid-x > .large-7, .grid-x > .large-8, .grid-x > .large-9, .grid-x > .large-10, .grid-x > .large-11, .grid-x > .large-12 {
    -ms-flex-preferred-size: auto;
        flex-basis: auto; } }

@media screen and (min-width: 80em) {
  .grid-x > .xlarge-shrink, .grid-x > .xlarge-full, .grid-x > .xlarge-1, .grid-x > .xlarge-2, .grid-x > .xlarge-3, .grid-x > .xlarge-4, .grid-x > .xlarge-5, .grid-x > .xlarge-6, .grid-x > .xlarge-7, .grid-x > .xlarge-8, .grid-x > .xlarge-9, .grid-x > .xlarge-10, .grid-x > .xlarge-11, .grid-x > .xlarge-12 {
    -ms-flex-preferred-size: auto;
        flex-basis: auto; } }

@media screen and (min-width: 100em) {
  .grid-x > .xxlarge-shrink, .grid-x > .xxlarge-full, .grid-x > .xxlarge-1, .grid-x > .xxlarge-2, .grid-x > .xxlarge-3, .grid-x > .xxlarge-4, .grid-x > .xxlarge-5, .grid-x > .xxlarge-6, .grid-x > .xxlarge-7, .grid-x > .xxlarge-8, .grid-x > .xxlarge-9, .grid-x > .xxlarge-10, .grid-x > .xxlarge-11, .grid-x > .xxlarge-12 {
    -ms-flex-preferred-size: auto;
        flex-basis: auto; } }

@media screen and (min-width: 120em) {
  .grid-x > .xxxlarge-shrink, .grid-x > .xxxlarge-full, .grid-x > .xxxlarge-1, .grid-x > .xxxlarge-2, .grid-x > .xxxlarge-3, .grid-x > .xxxlarge-4, .grid-x > .xxxlarge-5, .grid-x > .xxxlarge-6, .grid-x > .xxxlarge-7, .grid-x > .xxxlarge-8, .grid-x > .xxxlarge-9, .grid-x > .xxxlarge-10, .grid-x > .xxxlarge-11, .grid-x > .xxxlarge-12 {
    -ms-flex-preferred-size: auto;
        flex-basis: auto; } }

.grid-x > .small-1, .grid-x > .small-2, .grid-x > .small-3, .grid-x > .small-4, .grid-x > .small-5, .grid-x > .small-6, .grid-x > .small-7, .grid-x > .small-8, .grid-x > .small-9, .grid-x > .small-10, .grid-x > .small-11, .grid-x > .small-12 {
  -ms-flex: 0 0 auto;
      flex: 0 0 auto; }

.grid-x > .small-1 {
  width: 8.33333%; }

.grid-x > .small-2 {
  width: 16.66667%; }

.grid-x > .small-3 {
  width: 25%; }

.grid-x > .small-4 {
  width: 33.33333%; }

.grid-x > .small-5 {
  width: 41.66667%; }

.grid-x > .small-6 {
  width: 50%; }

.grid-x > .small-7 {
  width: 58.33333%; }

.grid-x > .small-8 {
  width: 66.66667%; }

.grid-x > .small-9 {
  width: 75%; }

.grid-x > .small-10 {
  width: 83.33333%; }

.grid-x > .small-11 {
  width: 91.66667%; }

.grid-x > .small-12 {
  width: 100%; }

@media print, screen and (min-width: 40em) {
  .grid-x > .medium-auto {
    -ms-flex: 1 1 0px;
        flex: 1 1 0px;
    width: auto; }
  .grid-x > .medium-shrink, .grid-x > .medium-1, .grid-x > .medium-2, .grid-x > .medium-3, .grid-x > .medium-4, .grid-x > .medium-5, .grid-x > .medium-6, .grid-x > .medium-7, .grid-x > .medium-8, .grid-x > .medium-9, .grid-x > .medium-10, .grid-x > .medium-11, .grid-x > .medium-12 {
    -ms-flex: 0 0 auto;
        flex: 0 0 auto; }
  .grid-x > .medium-shrink {
    width: auto; }
  .grid-x > .medium-1 {
    width: 8.33333%; }
  .grid-x > .medium-2 {
    width: 16.66667%; }
  .grid-x > .medium-3 {
    width: 25%; }
  .grid-x > .medium-4 {
    width: 33.33333%; }
  .grid-x > .medium-5 {
    width: 41.66667%; }
  .grid-x > .medium-6 {
    width: 50%; }
  .grid-x > .medium-7 {
    width: 58.33333%; }
  .grid-x > .medium-8 {
    width: 66.66667%; }
  .grid-x > .medium-9 {
    width: 75%; }
  .grid-x > .medium-10 {
    width: 83.33333%; }
  .grid-x > .medium-11 {
    width: 91.66667%; }
  .grid-x > .medium-12 {
    width: 100%; } }

@media print, screen and (min-width: 60em) {
  .grid-x > .large-auto {
    -ms-flex: 1 1 0px;
        flex: 1 1 0px;
    width: auto; }
  .grid-x > .large-shrink, .grid-x > .large-1, .grid-x > .large-2, .grid-x > .large-3, .grid-x > .large-4, .grid-x > .large-5, .grid-x > .large-6, .grid-x > .large-7, .grid-x > .large-8, .grid-x > .large-9, .grid-x > .large-10, .grid-x > .large-11, .grid-x > .large-12 {
    -ms-flex: 0 0 auto;
        flex: 0 0 auto; }
  .grid-x > .large-shrink {
    width: auto; }
  .grid-x > .large-1 {
    width: 8.33333%; }
  .grid-x > .large-2 {
    width: 16.66667%; }
  .grid-x > .large-3 {
    width: 25%; }
  .grid-x > .large-4 {
    width: 33.33333%; }
  .grid-x > .large-5 {
    width: 41.66667%; }
  .grid-x > .large-6 {
    width: 50%; }
  .grid-x > .large-7 {
    width: 58.33333%; }
  .grid-x > .large-8 {
    width: 66.66667%; }
  .grid-x > .large-9 {
    width: 75%; }
  .grid-x > .large-10 {
    width: 83.33333%; }
  .grid-x > .large-11 {
    width: 91.66667%; }
  .grid-x > .large-12 {
    width: 100%; } }

@media screen and (min-width: 80em) {
  .grid-x > .xlarge-auto {
    -ms-flex: 1 1 0px;
        flex: 1 1 0px;
    width: auto; }
  .grid-x > .xlarge-shrink, .grid-x > .xlarge-1, .grid-x > .xlarge-2, .grid-x > .xlarge-3, .grid-x > .xlarge-4, .grid-x > .xlarge-5, .grid-x > .xlarge-6, .grid-x > .xlarge-7, .grid-x > .xlarge-8, .grid-x > .xlarge-9, .grid-x > .xlarge-10, .grid-x > .xlarge-11, .grid-x > .xlarge-12 {
    -ms-flex: 0 0 auto;
        flex: 0 0 auto; }
  .grid-x > .xlarge-shrink {
    width: auto; }
  .grid-x > .xlarge-1 {
    width: 8.33333%; }
  .grid-x > .xlarge-2 {
    width: 16.66667%; }
  .grid-x > .xlarge-3 {
    width: 25%; }
  .grid-x > .xlarge-4 {
    width: 33.33333%; }
  .grid-x > .xlarge-5 {
    width: 41.66667%; }
  .grid-x > .xlarge-6 {
    width: 50%; }
  .grid-x > .xlarge-7 {
    width: 58.33333%; }
  .grid-x > .xlarge-8 {
    width: 66.66667%; }
  .grid-x > .xlarge-9 {
    width: 75%; }
  .grid-x > .xlarge-10 {
    width: 83.33333%; }
  .grid-x > .xlarge-11 {
    width: 91.66667%; }
  .grid-x > .xlarge-12 {
    width: 100%; } }

@media screen and (min-width: 100em) {
  .grid-x > .xxlarge-auto {
    -ms-flex: 1 1 0px;
        flex: 1 1 0px;
    width: auto; }
  .grid-x > .xxlarge-shrink, .grid-x > .xxlarge-1, .grid-x > .xxlarge-2, .grid-x > .xxlarge-3, .grid-x > .xxlarge-4, .grid-x > .xxlarge-5, .grid-x > .xxlarge-6, .grid-x > .xxlarge-7, .grid-x > .xxlarge-8, .grid-x > .xxlarge-9, .grid-x > .xxlarge-10, .grid-x > .xxlarge-11, .grid-x > .xxlarge-12 {
    -ms-flex: 0 0 auto;
        flex: 0 0 auto; }
  .grid-x > .xxlarge-shrink {
    width: auto; }
  .grid-x > .xxlarge-1 {
    width: 8.33333%; }
  .grid-x > .xxlarge-2 {
    width: 16.66667%; }
  .grid-x > .xxlarge-3 {
    width: 25%; }
  .grid-x > .xxlarge-4 {
    width: 33.33333%; }
  .grid-x > .xxlarge-5 {
    width: 41.66667%; }
  .grid-x > .xxlarge-6 {
    width: 50%; }
  .grid-x > .xxlarge-7 {
    width: 58.33333%; }
  .grid-x > .xxlarge-8 {
    width: 66.66667%; }
  .grid-x > .xxlarge-9 {
    width: 75%; }
  .grid-x > .xxlarge-10 {
    width: 83.33333%; }
  .grid-x > .xxlarge-11 {
    width: 91.66667%; }
  .grid-x > .xxlarge-12 {
    width: 100%; } }

@media screen and (min-width: 120em) {
  .grid-x > .xxxlarge-auto {
    -ms-flex: 1 1 0px;
        flex: 1 1 0px;
    width: auto; }
  .grid-x > .xxxlarge-shrink, .grid-x > .xxxlarge-1, .grid-x > .xxxlarge-2, .grid-x > .xxxlarge-3, .grid-x > .xxxlarge-4, .grid-x > .xxxlarge-5, .grid-x > .xxxlarge-6, .grid-x > .xxxlarge-7, .grid-x > .xxxlarge-8, .grid-x > .xxxlarge-9, .grid-x > .xxxlarge-10, .grid-x > .xxxlarge-11, .grid-x > .xxxlarge-12 {
    -ms-flex: 0 0 auto;
        flex: 0 0 auto; }
  .grid-x > .xxxlarge-shrink {
    width: auto; }
  .grid-x > .xxxlarge-1 {
    width: 8.33333%; }
  .grid-x > .xxxlarge-2 {
    width: 16.66667%; }
  .grid-x > .xxxlarge-3 {
    width: 25%; }
  .grid-x > .xxxlarge-4 {
    width: 33.33333%; }
  .grid-x > .xxxlarge-5 {
    width: 41.66667%; }
  .grid-x > .xxxlarge-6 {
    width: 50%; }
  .grid-x > .xxxlarge-7 {
    width: 58.33333%; }
  .grid-x > .xxxlarge-8 {
    width: 66.66667%; }
  .grid-x > .xxxlarge-9 {
    width: 75%; }
  .grid-x > .xxxlarge-10 {
    width: 83.33333%; }
  .grid-x > .xxxlarge-11 {
    width: 91.66667%; }
  .grid-x > .xxxlarge-12 {
    width: 100%; } }

.grid-margin-x:not(.grid-x) > .cell {
  width: auto; }

.grid-margin-y:not(.grid-y) > .cell {
  height: auto; }

.grid-margin-x {
  margin-left: -0.875rem;
  margin-right: -0.875rem; }
  @media print, screen and (min-width: 40em) {
    .grid-margin-x {
      margin-left: -0.875rem;
      margin-right: -0.875rem; } }
  .grid-margin-x > .cell {
    width: calc(100% - 1.75rem);
    margin-left: 0.875rem;
    margin-right: 0.875rem; }
  @media print, screen and (min-width: 40em) {
    .grid-margin-x > .cell {
      width: calc(100% - 1.75rem);
      margin-left: 0.875rem;
      margin-right: 0.875rem; } }
  .grid-margin-x > .auto {
    width: auto; }
  .grid-margin-x > .shrink {
    width: auto; }
  .grid-margin-x > .small-1 {
    width: calc(8.33333% - 1.75rem); }
  .grid-margin-x > .small-2 {
    width: calc(16.66667% - 1.75rem); }
  .grid-margin-x > .small-3 {
    width: calc(25% - 1.75rem); }
  .grid-margin-x > .small-4 {
    width: calc(33.33333% - 1.75rem); }
  .grid-margin-x > .small-5 {
    width: calc(41.66667% - 1.75rem); }
  .grid-margin-x > .small-6 {
    width: calc(50% - 1.75rem); }
  .grid-margin-x > .small-7 {
    width: calc(58.33333% - 1.75rem); }
  .grid-margin-x > .small-8 {
    width: calc(66.66667% - 1.75rem); }
  .grid-margin-x > .small-9 {
    width: calc(75% - 1.75rem); }
  .grid-margin-x > .small-10 {
    width: calc(83.33333% - 1.75rem); }
  .grid-margin-x > .small-11 {
    width: calc(91.66667% - 1.75rem); }
  .grid-margin-x > .small-12 {
    width: calc(100% - 1.75rem); }
  @media print, screen and (min-width: 40em) {
    .grid-margin-x > .auto {
      width: auto; }
    .grid-margin-x > .shrink {
      width: auto; }
    .grid-margin-x > .small-1 {
      width: calc(8.33333% - 1.75rem); }
    .grid-margin-x > .small-2 {
      width: calc(16.66667% - 1.75rem); }
    .grid-margin-x > .small-3 {
      width: calc(25% - 1.75rem); }
    .grid-margin-x > .small-4 {
      width: calc(33.33333% - 1.75rem); }
    .grid-margin-x > .small-5 {
      width: calc(41.66667% - 1.75rem); }
    .grid-margin-x > .small-6 {
      width: calc(50% - 1.75rem); }
    .grid-margin-x > .small-7 {
      width: calc(58.33333% - 1.75rem); }
    .grid-margin-x > .small-8 {
      width: calc(66.66667% - 1.75rem); }
    .grid-margin-x > .small-9 {
      width: calc(75% - 1.75rem); }
    .grid-margin-x > .small-10 {
      width: calc(83.33333% - 1.75rem); }
    .grid-margin-x > .small-11 {
      width: calc(91.66667% - 1.75rem); }
    .grid-margin-x > .small-12 {
      width: calc(100% - 1.75rem); }
    .grid-margin-x > .medium-auto {
      width: auto; }
    .grid-margin-x > .medium-shrink {
      width: auto; }
    .grid-margin-x > .medium-1 {
      width: calc(8.33333% - 1.75rem); }
    .grid-margin-x > .medium-2 {
      width: calc(16.66667% - 1.75rem); }
    .grid-margin-x > .medium-3 {
      width: calc(25% - 1.75rem); }
    .grid-margin-x > .medium-4 {
      width: calc(33.33333% - 1.75rem); }
    .grid-margin-x > .medium-5 {
      width: calc(41.66667% - 1.75rem); }
    .grid-margin-x > .medium-6 {
      width: calc(50% - 1.75rem); }
    .grid-margin-x > .medium-7 {
      width: calc(58.33333% - 1.75rem); }
    .grid-margin-x > .medium-8 {
      width: calc(66.66667% - 1.75rem); }
    .grid-margin-x > .medium-9 {
      width: calc(75% - 1.75rem); }
    .grid-margin-x > .medium-10 {
      width: calc(83.33333% - 1.75rem); }
    .grid-margin-x > .medium-11 {
      width: calc(91.66667% - 1.75rem); }
    .grid-margin-x > .medium-12 {
      width: calc(100% - 1.75rem); } }
  @media print, screen and (min-width: 60em) {
    .grid-margin-x > .large-auto {
      width: auto; }
    .grid-margin-x > .large-shrink {
      width: auto; }
    .grid-margin-x > .large-1 {
      width: calc(8.33333% - 1.75rem); }
    .grid-margin-x > .large-2 {
      width: calc(16.66667% - 1.75rem); }
    .grid-margin-x > .large-3 {
      width: calc(25% - 1.75rem); }
    .grid-margin-x > .large-4 {
      width: calc(33.33333% - 1.75rem); }
    .grid-margin-x > .large-5 {
      width: calc(41.66667% - 1.75rem); }
    .grid-margin-x > .large-6 {
      width: calc(50% - 1.75rem); }
    .grid-margin-x > .large-7 {
      width: calc(58.33333% - 1.75rem); }
    .grid-margin-x > .large-8 {
      width: calc(66.66667% - 1.75rem); }
    .grid-margin-x > .large-9 {
      width: calc(75% - 1.75rem); }
    .grid-margin-x > .large-10 {
      width: calc(83.33333% - 1.75rem); }
    .grid-margin-x > .large-11 {
      width: calc(91.66667% - 1.75rem); }
    .grid-margin-x > .large-12 {
      width: calc(100% - 1.75rem); } }
  @media screen and (min-width: 80em) {
    .grid-margin-x > .xlarge-auto {
      width: auto; }
    .grid-margin-x > .xlarge-shrink {
      width: auto; }
    .grid-margin-x > .xlarge-1 {
      width: calc(8.33333% - 1.75rem); }
    .grid-margin-x > .xlarge-2 {
      width: calc(16.66667% - 1.75rem); }
    .grid-margin-x > .xlarge-3 {
      width: calc(25% - 1.75rem); }
    .grid-margin-x > .xlarge-4 {
      width: calc(33.33333% - 1.75rem); }
    .grid-margin-x > .xlarge-5 {
      width: calc(41.66667% - 1.75rem); }
    .grid-margin-x > .xlarge-6 {
      width: calc(50% - 1.75rem); }
    .grid-margin-x > .xlarge-7 {
      width: calc(58.33333% - 1.75rem); }
    .grid-margin-x > .xlarge-8 {
      width: calc(66.66667% - 1.75rem); }
    .grid-margin-x > .xlarge-9 {
      width: calc(75% - 1.75rem); }
    .grid-margin-x > .xlarge-10 {
      width: calc(83.33333% - 1.75rem); }
    .grid-margin-x > .xlarge-11 {
      width: calc(91.66667% - 1.75rem); }
    .grid-margin-x > .xlarge-12 {
      width: calc(100% - 1.75rem); } }
  @media screen and (min-width: 100em) {
    .grid-margin-x > .xxlarge-auto {
      width: auto; }
    .grid-margin-x > .xxlarge-shrink {
      width: auto; }
    .grid-margin-x > .xxlarge-1 {
      width: calc(8.33333% - 1.75rem); }
    .grid-margin-x > .xxlarge-2 {
      width: calc(16.66667% - 1.75rem); }
    .grid-margin-x > .xxlarge-3 {
      width: calc(25% - 1.75rem); }
    .grid-margin-x > .xxlarge-4 {
      width: calc(33.33333% - 1.75rem); }
    .grid-margin-x > .xxlarge-5 {
      width: calc(41.66667% - 1.75rem); }
    .grid-margin-x > .xxlarge-6 {
      width: calc(50% - 1.75rem); }
    .grid-margin-x > .xxlarge-7 {
      width: calc(58.33333% - 1.75rem); }
    .grid-margin-x > .xxlarge-8 {
      width: calc(66.66667% - 1.75rem); }
    .grid-margin-x > .xxlarge-9 {
      width: calc(75% - 1.75rem); }
    .grid-margin-x > .xxlarge-10 {
      width: calc(83.33333% - 1.75rem); }
    .grid-margin-x > .xxlarge-11 {
      width: calc(91.66667% - 1.75rem); }
    .grid-margin-x > .xxlarge-12 {
      width: calc(100% - 1.75rem); } }
  @media screen and (min-width: 120em) {
    .grid-margin-x > .xxxlarge-auto {
      width: auto; }
    .grid-margin-x > .xxxlarge-shrink {
      width: auto; }
    .grid-margin-x > .xxxlarge-1 {
      width: calc(8.33333% - 1.75rem); }
    .grid-margin-x > .xxxlarge-2 {
      width: calc(16.66667% - 1.75rem); }
    .grid-margin-x > .xxxlarge-3 {
      width: calc(25% - 1.75rem); }
    .grid-margin-x > .xxxlarge-4 {
      width: calc(33.33333% - 1.75rem); }
    .grid-margin-x > .xxxlarge-5 {
      width: calc(41.66667% - 1.75rem); }
    .grid-margin-x > .xxxlarge-6 {
      width: calc(50% - 1.75rem); }
    .grid-margin-x > .xxxlarge-7 {
      width: calc(58.33333% - 1.75rem); }
    .grid-margin-x > .xxxlarge-8 {
      width: calc(66.66667% - 1.75rem); }
    .grid-margin-x > .xxxlarge-9 {
      width: calc(75% - 1.75rem); }
    .grid-margin-x > .xxxlarge-10 {
      width: calc(83.33333% - 1.75rem); }
    .grid-margin-x > .xxxlarge-11 {
      width: calc(91.66667% - 1.75rem); }
    .grid-margin-x > .xxxlarge-12 {
      width: calc(100% - 1.75rem); } }

.grid-padding-x .grid-padding-x {
  margin-right: -0.875rem;
  margin-left: -0.875rem; }
  @media print, screen and (min-width: 40em) {
    .grid-padding-x .grid-padding-x {
      margin-right: -0.875rem;
      margin-left: -0.875rem; } }

.grid-container:not(.full) > .grid-padding-x {
  margin-right: -0.875rem;
  margin-left: -0.875rem; }
  @media print, screen and (min-width: 40em) {
    .grid-container:not(.full) > .grid-padding-x {
      margin-right: -0.875rem;
      margin-left: -0.875rem; } }

.grid-padding-x > .cell {
  padding-right: 0.875rem;
  padding-left: 0.875rem; }
  @media print, screen and (min-width: 40em) {
    .grid-padding-x > .cell {
      padding-right: 0.875rem;
      padding-left: 0.875rem; } }

.small-up-1 > .cell {
  width: 100%; }

.small-up-2 > .cell {
  width: 50%; }

.small-up-3 > .cell {
  width: 33.33333%; }

.small-up-4 > .cell {
  width: 25%; }

.small-up-5 > .cell {
  width: 20%; }

.small-up-6 > .cell {
  width: 16.66667%; }

.small-up-7 > .cell {
  width: 14.28571%; }

.small-up-8 > .cell {
  width: 12.5%; }

.small-up-9 > .cell {
  width: 11.11111%; }

.small-up-10 > .cell {
  width: 10%; }

.small-up-11 > .cell {
  width: 9.09091%; }

.small-up-12 > .cell {
  width: 8.33333%; }

.small-up-13 > .cell {
  width: 7.69231%; }

.small-up-14 > .cell {
  width: 7.14286%; }

.small-up-15 > .cell {
  width: 6.66667%; }

.small-up-16 > .cell {
  width: 6.25%; }

@media print, screen and (min-width: 40em) {
  .medium-up-1 > .cell {
    width: 100%; }
  .medium-up-2 > .cell {
    width: 50%; }
  .medium-up-3 > .cell {
    width: 33.33333%; }
  .medium-up-4 > .cell {
    width: 25%; }
  .medium-up-5 > .cell {
    width: 20%; }
  .medium-up-6 > .cell {
    width: 16.66667%; }
  .medium-up-7 > .cell {
    width: 14.28571%; }
  .medium-up-8 > .cell {
    width: 12.5%; }
  .medium-up-9 > .cell {
    width: 11.11111%; }
  .medium-up-10 > .cell {
    width: 10%; }
  .medium-up-11 > .cell {
    width: 9.09091%; }
  .medium-up-12 > .cell {
    width: 8.33333%; }
  .medium-up-13 > .cell {
    width: 7.69231%; }
  .medium-up-14 > .cell {
    width: 7.14286%; }
  .medium-up-15 > .cell {
    width: 6.66667%; }
  .medium-up-16 > .cell {
    width: 6.25%; } }

@media print, screen and (min-width: 60em) {
  .large-up-1 > .cell {
    width: 100%; }
  .large-up-2 > .cell {
    width: 50%; }
  .large-up-3 > .cell {
    width: 33.33333%; }
  .large-up-4 > .cell {
    width: 25%; }
  .large-up-5 > .cell {
    width: 20%; }
  .large-up-6 > .cell {
    width: 16.66667%; }
  .large-up-7 > .cell {
    width: 14.28571%; }
  .large-up-8 > .cell {
    width: 12.5%; }
  .large-up-9 > .cell {
    width: 11.11111%; }
  .large-up-10 > .cell {
    width: 10%; }
  .large-up-11 > .cell {
    width: 9.09091%; }
  .large-up-12 > .cell {
    width: 8.33333%; }
  .large-up-13 > .cell {
    width: 7.69231%; }
  .large-up-14 > .cell {
    width: 7.14286%; }
  .large-up-15 > .cell {
    width: 6.66667%; }
  .large-up-16 > .cell {
    width: 6.25%; } }

@media screen and (min-width: 80em) {
  .xlarge-up-1 > .cell {
    width: 100%; }
  .xlarge-up-2 > .cell {
    width: 50%; }
  .xlarge-up-3 > .cell {
    width: 33.33333%; }
  .xlarge-up-4 > .cell {
    width: 25%; }
  .xlarge-up-5 > .cell {
    width: 20%; }
  .xlarge-up-6 > .cell {
    width: 16.66667%; }
  .xlarge-up-7 > .cell {
    width: 14.28571%; }
  .xlarge-up-8 > .cell {
    width: 12.5%; }
  .xlarge-up-9 > .cell {
    width: 11.11111%; }
  .xlarge-up-10 > .cell {
    width: 10%; }
  .xlarge-up-11 > .cell {
    width: 9.09091%; }
  .xlarge-up-12 > .cell {
    width: 8.33333%; }
  .xlarge-up-13 > .cell {
    width: 7.69231%; }
  .xlarge-up-14 > .cell {
    width: 7.14286%; }
  .xlarge-up-15 > .cell {
    width: 6.66667%; }
  .xlarge-up-16 > .cell {
    width: 6.25%; } }

@media screen and (min-width: 100em) {
  .xxlarge-up-1 > .cell {
    width: 100%; }
  .xxlarge-up-2 > .cell {
    width: 50%; }
  .xxlarge-up-3 > .cell {
    width: 33.33333%; }
  .xxlarge-up-4 > .cell {
    width: 25%; }
  .xxlarge-up-5 > .cell {
    width: 20%; }
  .xxlarge-up-6 > .cell {
    width: 16.66667%; }
  .xxlarge-up-7 > .cell {
    width: 14.28571%; }
  .xxlarge-up-8 > .cell {
    width: 12.5%; }
  .xxlarge-up-9 > .cell {
    width: 11.11111%; }
  .xxlarge-up-10 > .cell {
    width: 10%; }
  .xxlarge-up-11 > .cell {
    width: 9.09091%; }
  .xxlarge-up-12 > .cell {
    width: 8.33333%; }
  .xxlarge-up-13 > .cell {
    width: 7.69231%; }
  .xxlarge-up-14 > .cell {
    width: 7.14286%; }
  .xxlarge-up-15 > .cell {
    width: 6.66667%; }
  .xxlarge-up-16 > .cell {
    width: 6.25%; } }

@media screen and (min-width: 120em) {
  .xxxlarge-up-1 > .cell {
    width: 100%; }
  .xxxlarge-up-2 > .cell {
    width: 50%; }
  .xxxlarge-up-3 > .cell {
    width: 33.33333%; }
  .xxxlarge-up-4 > .cell {
    width: 25%; }
  .xxxlarge-up-5 > .cell {
    width: 20%; }
  .xxxlarge-up-6 > .cell {
    width: 16.66667%; }
  .xxxlarge-up-7 > .cell {
    width: 14.28571%; }
  .xxxlarge-up-8 > .cell {
    width: 12.5%; }
  .xxxlarge-up-9 > .cell {
    width: 11.11111%; }
  .xxxlarge-up-10 > .cell {
    width: 10%; }
  .xxxlarge-up-11 > .cell {
    width: 9.09091%; }
  .xxxlarge-up-12 > .cell {
    width: 8.33333%; }
  .xxxlarge-up-13 > .cell {
    width: 7.69231%; }
  .xxxlarge-up-14 > .cell {
    width: 7.14286%; }
  .xxxlarge-up-15 > .cell {
    width: 6.66667%; }
  .xxxlarge-up-16 > .cell {
    width: 6.25%; } }

.grid-margin-x.small-up-1 > .cell {
  width: calc(100% - 1.75rem); }

.grid-margin-x.small-up-2 > .cell {
  width: calc(50% - 1.75rem); }

.grid-margin-x.small-up-3 > .cell {
  width: calc(33.33333% - 1.75rem); }

.grid-margin-x.small-up-4 > .cell {
  width: calc(25% - 1.75rem); }

.grid-margin-x.small-up-5 > .cell {
  width: calc(20% - 1.75rem); }

.grid-margin-x.small-up-6 > .cell {
  width: calc(16.66667% - 1.75rem); }

.grid-margin-x.small-up-7 > .cell {
  width: calc(14.28571% - 1.75rem); }

.grid-margin-x.small-up-8 > .cell {
  width: calc(12.5% - 1.75rem); }

.grid-margin-x.small-up-9 > .cell {
  width: calc(11.11111% - 1.75rem); }

.grid-margin-x.small-up-10 > .cell {
  width: calc(10% - 1.75rem); }

.grid-margin-x.small-up-11 > .cell {
  width: calc(9.09091% - 1.75rem); }

.grid-margin-x.small-up-12 > .cell {
  width: calc(8.33333% - 1.75rem); }

.grid-margin-x.small-up-13 > .cell {
  width: calc(7.69231% - 1.75rem); }

.grid-margin-x.small-up-14 > .cell {
  width: calc(7.14286% - 1.75rem); }

.grid-margin-x.small-up-15 > .cell {
  width: calc(6.66667% - 1.75rem); }

.grid-margin-x.small-up-16 > .cell {
  width: calc(6.25% - 1.75rem); }

@media print, screen and (min-width: 40em) {
  .grid-margin-x.small-up-1 > .cell {
    width: calc(100% - 1.75rem); }
  .grid-margin-x.small-up-2 > .cell {
    width: calc(50% - 1.75rem); }
  .grid-margin-x.small-up-3 > .cell {
    width: calc(33.33333% - 1.75rem); }
  .grid-margin-x.small-up-4 > .cell {
    width: calc(25% - 1.75rem); }
  .grid-margin-x.small-up-5 > .cell {
    width: calc(20% - 1.75rem); }
  .grid-margin-x.small-up-6 > .cell {
    width: calc(16.66667% - 1.75rem); }
  .grid-margin-x.small-up-7 > .cell {
    width: calc(14.28571% - 1.75rem); }
  .grid-margin-x.small-up-8 > .cell {
    width: calc(12.5% - 1.75rem); }
  .grid-margin-x.small-up-9 > .cell {
    width: calc(11.11111% - 1.75rem); }
  .grid-margin-x.small-up-10 > .cell {
    width: calc(10% - 1.75rem); }
  .grid-margin-x.small-up-11 > .cell {
    width: calc(9.09091% - 1.75rem); }
  .grid-margin-x.small-up-12 > .cell {
    width: calc(8.33333% - 1.75rem); }
  .grid-margin-x.small-up-13 > .cell {
    width: calc(7.69231% - 1.75rem); }
  .grid-margin-x.small-up-14 > .cell {
    width: calc(7.14286% - 1.75rem); }
  .grid-margin-x.small-up-15 > .cell {
    width: calc(6.66667% - 1.75rem); }
  .grid-margin-x.small-up-16 > .cell {
    width: calc(6.25% - 1.75rem); }
  .grid-margin-x.medium-up-1 > .cell {
    width: calc(100% - 1.75rem); }
  .grid-margin-x.medium-up-2 > .cell {
    width: calc(50% - 1.75rem); }
  .grid-margin-x.medium-up-3 > .cell {
    width: calc(33.33333% - 1.75rem); }
  .grid-margin-x.medium-up-4 > .cell {
    width: calc(25% - 1.75rem); }
  .grid-margin-x.medium-up-5 > .cell {
    width: calc(20% - 1.75rem); }
  .grid-margin-x.medium-up-6 > .cell {
    width: calc(16.66667% - 1.75rem); }
  .grid-margin-x.medium-up-7 > .cell {
    width: calc(14.28571% - 1.75rem); }
  .grid-margin-x.medium-up-8 > .cell {
    width: calc(12.5% - 1.75rem); }
  .grid-margin-x.medium-up-9 > .cell {
    width: calc(11.11111% - 1.75rem); }
  .grid-margin-x.medium-up-10 > .cell {
    width: calc(10% - 1.75rem); }
  .grid-margin-x.medium-up-11 > .cell {
    width: calc(9.09091% - 1.75rem); }
  .grid-margin-x.medium-up-12 > .cell {
    width: calc(8.33333% - 1.75rem); }
  .grid-margin-x.medium-up-13 > .cell {
    width: calc(7.69231% - 1.75rem); }
  .grid-margin-x.medium-up-14 > .cell {
    width: calc(7.14286% - 1.75rem); }
  .grid-margin-x.medium-up-15 > .cell {
    width: calc(6.66667% - 1.75rem); }
  .grid-margin-x.medium-up-16 > .cell {
    width: calc(6.25% - 1.75rem); } }

@media print, screen and (min-width: 60em) {
  .grid-margin-x.large-up-1 > .cell {
    width: calc(100% - 1.75rem); }
  .grid-margin-x.large-up-2 > .cell {
    width: calc(50% - 1.75rem); }
  .grid-margin-x.large-up-3 > .cell {
    width: calc(33.33333% - 1.75rem); }
  .grid-margin-x.large-up-4 > .cell {
    width: calc(25% - 1.75rem); }
  .grid-margin-x.large-up-5 > .cell {
    width: calc(20% - 1.75rem); }
  .grid-margin-x.large-up-6 > .cell {
    width: calc(16.66667% - 1.75rem); }
  .grid-margin-x.large-up-7 > .cell {
    width: calc(14.28571% - 1.75rem); }
  .grid-margin-x.large-up-8 > .cell {
    width: calc(12.5% - 1.75rem); }
  .grid-margin-x.large-up-9 > .cell {
    width: calc(11.11111% - 1.75rem); }
  .grid-margin-x.large-up-10 > .cell {
    width: calc(10% - 1.75rem); }
  .grid-margin-x.large-up-11 > .cell {
    width: calc(9.09091% - 1.75rem); }
  .grid-margin-x.large-up-12 > .cell {
    width: calc(8.33333% - 1.75rem); }
  .grid-margin-x.large-up-13 > .cell {
    width: calc(7.69231% - 1.75rem); }
  .grid-margin-x.large-up-14 > .cell {
    width: calc(7.14286% - 1.75rem); }
  .grid-margin-x.large-up-15 > .cell {
    width: calc(6.66667% - 1.75rem); }
  .grid-margin-x.large-up-16 > .cell {
    width: calc(6.25% - 1.75rem); } }

@media screen and (min-width: 80em) {
  .grid-margin-x.xlarge-up-1 > .cell {
    width: calc(100% - 1.75rem); }
  .grid-margin-x.xlarge-up-2 > .cell {
    width: calc(50% - 1.75rem); }
  .grid-margin-x.xlarge-up-3 > .cell {
    width: calc(33.33333% - 1.75rem); }
  .grid-margin-x.xlarge-up-4 > .cell {
    width: calc(25% - 1.75rem); }
  .grid-margin-x.xlarge-up-5 > .cell {
    width: calc(20% - 1.75rem); }
  .grid-margin-x.xlarge-up-6 > .cell {
    width: calc(16.66667% - 1.75rem); }
  .grid-margin-x.xlarge-up-7 > .cell {
    width: calc(14.28571% - 1.75rem); }
  .grid-margin-x.xlarge-up-8 > .cell {
    width: calc(12.5% - 1.75rem); }
  .grid-margin-x.xlarge-up-9 > .cell {
    width: calc(11.11111% - 1.75rem); }
  .grid-margin-x.xlarge-up-10 > .cell {
    width: calc(10% - 1.75rem); }
  .grid-margin-x.xlarge-up-11 > .cell {
    width: calc(9.09091% - 1.75rem); }
  .grid-margin-x.xlarge-up-12 > .cell {
    width: calc(8.33333% - 1.75rem); }
  .grid-margin-x.xlarge-up-13 > .cell {
    width: calc(7.69231% - 1.75rem); }
  .grid-margin-x.xlarge-up-14 > .cell {
    width: calc(7.14286% - 1.75rem); }
  .grid-margin-x.xlarge-up-15 > .cell {
    width: calc(6.66667% - 1.75rem); }
  .grid-margin-x.xlarge-up-16 > .cell {
    width: calc(6.25% - 1.75rem); } }

@media screen and (min-width: 100em) {
  .grid-margin-x.xxlarge-up-1 > .cell {
    width: calc(100% - 1.75rem); }
  .grid-margin-x.xxlarge-up-2 > .cell {
    width: calc(50% - 1.75rem); }
  .grid-margin-x.xxlarge-up-3 > .cell {
    width: calc(33.33333% - 1.75rem); }
  .grid-margin-x.xxlarge-up-4 > .cell {
    width: calc(25% - 1.75rem); }
  .grid-margin-x.xxlarge-up-5 > .cell {
    width: calc(20% - 1.75rem); }
  .grid-margin-x.xxlarge-up-6 > .cell {
    width: calc(16.66667% - 1.75rem); }
  .grid-margin-x.xxlarge-up-7 > .cell {
    width: calc(14.28571% - 1.75rem); }
  .grid-margin-x.xxlarge-up-8 > .cell {
    width: calc(12.5% - 1.75rem); }
  .grid-margin-x.xxlarge-up-9 > .cell {
    width: calc(11.11111% - 1.75rem); }
  .grid-margin-x.xxlarge-up-10 > .cell {
    width: calc(10% - 1.75rem); }
  .grid-margin-x.xxlarge-up-11 > .cell {
    width: calc(9.09091% - 1.75rem); }
  .grid-margin-x.xxlarge-up-12 > .cell {
    width: calc(8.33333% - 1.75rem); }
  .grid-margin-x.xxlarge-up-13 > .cell {
    width: calc(7.69231% - 1.75rem); }
  .grid-margin-x.xxlarge-up-14 > .cell {
    width: calc(7.14286% - 1.75rem); }
  .grid-margin-x.xxlarge-up-15 > .cell {
    width: calc(6.66667% - 1.75rem); }
  .grid-margin-x.xxlarge-up-16 > .cell {
    width: calc(6.25% - 1.75rem); } }

@media screen and (min-width: 120em) {
  .grid-margin-x.xxxlarge-up-1 > .cell {
    width: calc(100% - 1.75rem); }
  .grid-margin-x.xxxlarge-up-2 > .cell {
    width: calc(50% - 1.75rem); }
  .grid-margin-x.xxxlarge-up-3 > .cell {
    width: calc(33.33333% - 1.75rem); }
  .grid-margin-x.xxxlarge-up-4 > .cell {
    width: calc(25% - 1.75rem); }
  .grid-margin-x.xxxlarge-up-5 > .cell {
    width: calc(20% - 1.75rem); }
  .grid-margin-x.xxxlarge-up-6 > .cell {
    width: calc(16.66667% - 1.75rem); }
  .grid-margin-x.xxxlarge-up-7 > .cell {
    width: calc(14.28571% - 1.75rem); }
  .grid-margin-x.xxxlarge-up-8 > .cell {
    width: calc(12.5% - 1.75rem); }
  .grid-margin-x.xxxlarge-up-9 > .cell {
    width: calc(11.11111% - 1.75rem); }
  .grid-margin-x.xxxlarge-up-10 > .cell {
    width: calc(10% - 1.75rem); }
  .grid-margin-x.xxxlarge-up-11 > .cell {
    width: calc(9.09091% - 1.75rem); }
  .grid-margin-x.xxxlarge-up-12 > .cell {
    width: calc(8.33333% - 1.75rem); }
  .grid-margin-x.xxxlarge-up-13 > .cell {
    width: calc(7.69231% - 1.75rem); }
  .grid-margin-x.xxxlarge-up-14 > .cell {
    width: calc(7.14286% - 1.75rem); }
  .grid-margin-x.xxxlarge-up-15 > .cell {
    width: calc(6.66667% - 1.75rem); }
  .grid-margin-x.xxxlarge-up-16 > .cell {
    width: calc(6.25% - 1.75rem); } }

.small-margin-collapse {
  margin-right: 0;
  margin-left: 0; }
  .small-margin-collapse > .cell {
    margin-right: 0;
    margin-left: 0; }
  .small-margin-collapse > .small-1 {
    width: 8.33333%; }
  .small-margin-collapse > .small-2 {
    width: 16.66667%; }
  .small-margin-collapse > .small-3 {
    width: 25%; }
  .small-margin-collapse > .small-4 {
    width: 33.33333%; }
  .small-margin-collapse > .small-5 {
    width: 41.66667%; }
  .small-margin-collapse > .small-6 {
    width: 50%; }
  .small-margin-collapse > .small-7 {
    width: 58.33333%; }
  .small-margin-collapse > .small-8 {
    width: 66.66667%; }
  .small-margin-collapse > .small-9 {
    width: 75%; }
  .small-margin-collapse > .small-10 {
    width: 83.33333%; }
  .small-margin-collapse > .small-11 {
    width: 91.66667%; }
  .small-margin-collapse > .small-12 {
    width: 100%; }
  @media print, screen and (min-width: 40em) {
    .small-margin-collapse > .medium-1 {
      width: 8.33333%; }
    .small-margin-collapse > .medium-2 {
      width: 16.66667%; }
    .small-margin-collapse > .medium-3 {
      width: 25%; }
    .small-margin-collapse > .medium-4 {
      width: 33.33333%; }
    .small-margin-collapse > .medium-5 {
      width: 41.66667%; }
    .small-margin-collapse > .medium-6 {
      width: 50%; }
    .small-margin-collapse > .medium-7 {
      width: 58.33333%; }
    .small-margin-collapse > .medium-8 {
      width: 66.66667%; }
    .small-margin-collapse > .medium-9 {
      width: 75%; }
    .small-margin-collapse > .medium-10 {
      width: 83.33333%; }
    .small-margin-collapse > .medium-11 {
      width: 91.66667%; }
    .small-margin-collapse > .medium-12 {
      width: 100%; } }
  @media print, screen and (min-width: 60em) {
    .small-margin-collapse > .large-1 {
      width: 8.33333%; }
    .small-margin-collapse > .large-2 {
      width: 16.66667%; }
    .small-margin-collapse > .large-3 {
      width: 25%; }
    .small-margin-collapse > .large-4 {
      width: 33.33333%; }
    .small-margin-collapse > .large-5 {
      width: 41.66667%; }
    .small-margin-collapse > .large-6 {
      width: 50%; }
    .small-margin-collapse > .large-7 {
      width: 58.33333%; }
    .small-margin-collapse > .large-8 {
      width: 66.66667%; }
    .small-margin-collapse > .large-9 {
      width: 75%; }
    .small-margin-collapse > .large-10 {
      width: 83.33333%; }
    .small-margin-collapse > .large-11 {
      width: 91.66667%; }
    .small-margin-collapse > .large-12 {
      width: 100%; } }
  @media screen and (min-width: 80em) {
    .small-margin-collapse > .xlarge-1 {
      width: 8.33333%; }
    .small-margin-collapse > .xlarge-2 {
      width: 16.66667%; }
    .small-margin-collapse > .xlarge-3 {
      width: 25%; }
    .small-margin-collapse > .xlarge-4 {
      width: 33.33333%; }
    .small-margin-collapse > .xlarge-5 {
      width: 41.66667%; }
    .small-margin-collapse > .xlarge-6 {
      width: 50%; }
    .small-margin-collapse > .xlarge-7 {
      width: 58.33333%; }
    .small-margin-collapse > .xlarge-8 {
      width: 66.66667%; }
    .small-margin-collapse > .xlarge-9 {
      width: 75%; }
    .small-margin-collapse > .xlarge-10 {
      width: 83.33333%; }
    .small-margin-collapse > .xlarge-11 {
      width: 91.66667%; }
    .small-margin-collapse > .xlarge-12 {
      width: 100%; } }
  @media screen and (min-width: 100em) {
    .small-margin-collapse > .xxlarge-1 {
      width: 8.33333%; }
    .small-margin-collapse > .xxlarge-2 {
      width: 16.66667%; }
    .small-margin-collapse > .xxlarge-3 {
      width: 25%; }
    .small-margin-collapse > .xxlarge-4 {
      width: 33.33333%; }
    .small-margin-collapse > .xxlarge-5 {
      width: 41.66667%; }
    .small-margin-collapse > .xxlarge-6 {
      width: 50%; }
    .small-margin-collapse > .xxlarge-7 {
      width: 58.33333%; }
    .small-margin-collapse > .xxlarge-8 {
      width: 66.66667%; }
    .small-margin-collapse > .xxlarge-9 {
      width: 75%; }
    .small-margin-collapse > .xxlarge-10 {
      width: 83.33333%; }
    .small-margin-collapse > .xxlarge-11 {
      width: 91.66667%; }
    .small-margin-collapse > .xxlarge-12 {
      width: 100%; } }
  @media screen and (min-width: 120em) {
    .small-margin-collapse > .xxxlarge-1 {
      width: 8.33333%; }
    .small-margin-collapse > .xxxlarge-2 {
      width: 16.66667%; }
    .small-margin-collapse > .xxxlarge-3 {
      width: 25%; }
    .small-margin-collapse > .xxxlarge-4 {
      width: 33.33333%; }
    .small-margin-collapse > .xxxlarge-5 {
      width: 41.66667%; }
    .small-margin-collapse > .xxxlarge-6 {
      width: 50%; }
    .small-margin-collapse > .xxxlarge-7 {
      width: 58.33333%; }
    .small-margin-collapse > .xxxlarge-8 {
      width: 66.66667%; }
    .small-margin-collapse > .xxxlarge-9 {
      width: 75%; }
    .small-margin-collapse > .xxxlarge-10 {
      width: 83.33333%; }
    .small-margin-collapse > .xxxlarge-11 {
      width: 91.66667%; }
    .small-margin-collapse > .xxxlarge-12 {
      width: 100%; } }

.small-padding-collapse {
  margin-right: 0;
  margin-left: 0; }
  .small-padding-collapse > .cell {
    padding-right: 0;
    padding-left: 0; }

@media print, screen and (min-width: 40em) {
  .medium-margin-collapse {
    margin-right: 0;
    margin-left: 0; }
    .medium-margin-collapse > .cell {
      margin-right: 0;
      margin-left: 0; } }

@media print, screen and (min-width: 40em) {
  .medium-margin-collapse > .small-1 {
    width: 8.33333%; }
  .medium-margin-collapse > .small-2 {
    width: 16.66667%; }
  .medium-margin-collapse > .small-3 {
    width: 25%; }
  .medium-margin-collapse > .small-4 {
    width: 33.33333%; }
  .medium-margin-collapse > .small-5 {
    width: 41.66667%; }
  .medium-margin-collapse > .small-6 {
    width: 50%; }
  .medium-margin-collapse > .small-7 {
    width: 58.33333%; }
  .medium-margin-collapse > .small-8 {
    width: 66.66667%; }
  .medium-margin-collapse > .small-9 {
    width: 75%; }
  .medium-margin-collapse > .small-10 {
    width: 83.33333%; }
  .medium-margin-collapse > .small-11 {
    width: 91.66667%; }
  .medium-margin-collapse > .small-12 {
    width: 100%; } }

@media print, screen and (min-width: 40em) {
  .medium-margin-collapse > .medium-1 {
    width: 8.33333%; }
  .medium-margin-collapse > .medium-2 {
    width: 16.66667%; }
  .medium-margin-collapse > .medium-3 {
    width: 25%; }
  .medium-margin-collapse > .medium-4 {
    width: 33.33333%; }
  .medium-margin-collapse > .medium-5 {
    width: 41.66667%; }
  .medium-margin-collapse > .medium-6 {
    width: 50%; }
  .medium-margin-collapse > .medium-7 {
    width: 58.33333%; }
  .medium-margin-collapse > .medium-8 {
    width: 66.66667%; }
  .medium-margin-collapse > .medium-9 {
    width: 75%; }
  .medium-margin-collapse > .medium-10 {
    width: 83.33333%; }
  .medium-margin-collapse > .medium-11 {
    width: 91.66667%; }
  .medium-margin-collapse > .medium-12 {
    width: 100%; } }

@media print, screen and (min-width: 60em) {
  .medium-margin-collapse > .large-1 {
    width: 8.33333%; }
  .medium-margin-collapse > .large-2 {
    width: 16.66667%; }
  .medium-margin-collapse > .large-3 {
    width: 25%; }
  .medium-margin-collapse > .large-4 {
    width: 33.33333%; }
  .medium-margin-collapse > .large-5 {
    width: 41.66667%; }
  .medium-margin-collapse > .large-6 {
    width: 50%; }
  .medium-margin-collapse > .large-7 {
    width: 58.33333%; }
  .medium-margin-collapse > .large-8 {
    width: 66.66667%; }
  .medium-margin-collapse > .large-9 {
    width: 75%; }
  .medium-margin-collapse > .large-10 {
    width: 83.33333%; }
  .medium-margin-collapse > .large-11 {
    width: 91.66667%; }
  .medium-margin-collapse > .large-12 {
    width: 100%; } }

@media screen and (min-width: 80em) {
  .medium-margin-collapse > .xlarge-1 {
    width: 8.33333%; }
  .medium-margin-collapse > .xlarge-2 {
    width: 16.66667%; }
  .medium-margin-collapse > .xlarge-3 {
    width: 25%; }
  .medium-margin-collapse > .xlarge-4 {
    width: 33.33333%; }
  .medium-margin-collapse > .xlarge-5 {
    width: 41.66667%; }
  .medium-margin-collapse > .xlarge-6 {
    width: 50%; }
  .medium-margin-collapse > .xlarge-7 {
    width: 58.33333%; }
  .medium-margin-collapse > .xlarge-8 {
    width: 66.66667%; }
  .medium-margin-collapse > .xlarge-9 {
    width: 75%; }
  .medium-margin-collapse > .xlarge-10 {
    width: 83.33333%; }
  .medium-margin-collapse > .xlarge-11 {
    width: 91.66667%; }
  .medium-margin-collapse > .xlarge-12 {
    width: 100%; } }

@media screen and (min-width: 100em) {
  .medium-margin-collapse > .xxlarge-1 {
    width: 8.33333%; }
  .medium-margin-collapse > .xxlarge-2 {
    width: 16.66667%; }
  .medium-margin-collapse > .xxlarge-3 {
    width: 25%; }
  .medium-margin-collapse > .xxlarge-4 {
    width: 33.33333%; }
  .medium-margin-collapse > .xxlarge-5 {
    width: 41.66667%; }
  .medium-margin-collapse > .xxlarge-6 {
    width: 50%; }
  .medium-margin-collapse > .xxlarge-7 {
    width: 58.33333%; }
  .medium-margin-collapse > .xxlarge-8 {
    width: 66.66667%; }
  .medium-margin-collapse > .xxlarge-9 {
    width: 75%; }
  .medium-margin-collapse > .xxlarge-10 {
    width: 83.33333%; }
  .medium-margin-collapse > .xxlarge-11 {
    width: 91.66667%; }
  .medium-margin-collapse > .xxlarge-12 {
    width: 100%; } }

@media screen and (min-width: 120em) {
  .medium-margin-collapse > .xxxlarge-1 {
    width: 8.33333%; }
  .medium-margin-collapse > .xxxlarge-2 {
    width: 16.66667%; }
  .medium-margin-collapse > .xxxlarge-3 {
    width: 25%; }
  .medium-margin-collapse > .xxxlarge-4 {
    width: 33.33333%; }
  .medium-margin-collapse > .xxxlarge-5 {
    width: 41.66667%; }
  .medium-margin-collapse > .xxxlarge-6 {
    width: 50%; }
  .medium-margin-collapse > .xxxlarge-7 {
    width: 58.33333%; }
  .medium-margin-collapse > .xxxlarge-8 {
    width: 66.66667%; }
  .medium-margin-collapse > .xxxlarge-9 {
    width: 75%; }
  .medium-margin-collapse > .xxxlarge-10 {
    width: 83.33333%; }
  .medium-margin-collapse > .xxxlarge-11 {
    width: 91.66667%; }
  .medium-margin-collapse > .xxxlarge-12 {
    width: 100%; } }

@media print, screen and (min-width: 40em) {
  .medium-padding-collapse {
    margin-right: 0;
    margin-left: 0; }
    .medium-padding-collapse > .cell {
      padding-right: 0;
      padding-left: 0; } }

@media print, screen and (min-width: 60em) {
  .large-margin-collapse {
    margin-right: 0;
    margin-left: 0; }
    .large-margin-collapse > .cell {
      margin-right: 0;
      margin-left: 0; } }

@media print, screen and (min-width: 60em) {
  .large-margin-collapse > .small-1 {
    width: 8.33333%; }
  .large-margin-collapse > .small-2 {
    width: 16.66667%; }
  .large-margin-collapse > .small-3 {
    width: 25%; }
  .large-margin-collapse > .small-4 {
    width: 33.33333%; }
  .large-margin-collapse > .small-5 {
    width: 41.66667%; }
  .large-margin-collapse > .small-6 {
    width: 50%; }
  .large-margin-collapse > .small-7 {
    width: 58.33333%; }
  .large-margin-collapse > .small-8 {
    width: 66.66667%; }
  .large-margin-collapse > .small-9 {
    width: 75%; }
  .large-margin-collapse > .small-10 {
    width: 83.33333%; }
  .large-margin-collapse > .small-11 {
    width: 91.66667%; }
  .large-margin-collapse > .small-12 {
    width: 100%; } }

@media print, screen and (min-width: 60em) {
  .large-margin-collapse > .medium-1 {
    width: 8.33333%; }
  .large-margin-collapse > .medium-2 {
    width: 16.66667%; }
  .large-margin-collapse > .medium-3 {
    width: 25%; }
  .large-margin-collapse > .medium-4 {
    width: 33.33333%; }
  .large-margin-collapse > .medium-5 {
    width: 41.66667%; }
  .large-margin-collapse > .medium-6 {
    width: 50%; }
  .large-margin-collapse > .medium-7 {
    width: 58.33333%; }
  .large-margin-collapse > .medium-8 {
    width: 66.66667%; }
  .large-margin-collapse > .medium-9 {
    width: 75%; }
  .large-margin-collapse > .medium-10 {
    width: 83.33333%; }
  .large-margin-collapse > .medium-11 {
    width: 91.66667%; }
  .large-margin-collapse > .medium-12 {
    width: 100%; } }

@media print, screen and (min-width: 60em) {
  .large-margin-collapse > .large-1 {
    width: 8.33333%; }
  .large-margin-collapse > .large-2 {
    width: 16.66667%; }
  .large-margin-collapse > .large-3 {
    width: 25%; }
  .large-margin-collapse > .large-4 {
    width: 33.33333%; }
  .large-margin-collapse > .large-5 {
    width: 41.66667%; }
  .large-margin-collapse > .large-6 {
    width: 50%; }
  .large-margin-collapse > .large-7 {
    width: 58.33333%; }
  .large-margin-collapse > .large-8 {
    width: 66.66667%; }
  .large-margin-collapse > .large-9 {
    width: 75%; }
  .large-margin-collapse > .large-10 {
    width: 83.33333%; }
  .large-margin-collapse > .large-11 {
    width: 91.66667%; }
  .large-margin-collapse > .large-12 {
    width: 100%; } }

@media screen and (min-width: 80em) {
  .large-margin-collapse > .xlarge-1 {
    width: 8.33333%; }
  .large-margin-collapse > .xlarge-2 {
    width: 16.66667%; }
  .large-margin-collapse > .xlarge-3 {
    width: 25%; }
  .large-margin-collapse > .xlarge-4 {
    width: 33.33333%; }
  .large-margin-collapse > .xlarge-5 {
    width: 41.66667%; }
  .large-margin-collapse > .xlarge-6 {
    width: 50%; }
  .large-margin-collapse > .xlarge-7 {
    width: 58.33333%; }
  .large-margin-collapse > .xlarge-8 {
    width: 66.66667%; }
  .large-margin-collapse > .xlarge-9 {
    width: 75%; }
  .large-margin-collapse > .xlarge-10 {
    width: 83.33333%; }
  .large-margin-collapse > .xlarge-11 {
    width: 91.66667%; }
  .large-margin-collapse > .xlarge-12 {
    width: 100%; } }

@media screen and (min-width: 100em) {
  .large-margin-collapse > .xxlarge-1 {
    width: 8.33333%; }
  .large-margin-collapse > .xxlarge-2 {
    width: 16.66667%; }
  .large-margin-collapse > .xxlarge-3 {
    width: 25%; }
  .large-margin-collapse > .xxlarge-4 {
    width: 33.33333%; }
  .large-margin-collapse > .xxlarge-5 {
    width: 41.66667%; }
  .large-margin-collapse > .xxlarge-6 {
    width: 50%; }
  .large-margin-collapse > .xxlarge-7 {
    width: 58.33333%; }
  .large-margin-collapse > .xxlarge-8 {
    width: 66.66667%; }
  .large-margin-collapse > .xxlarge-9 {
    width: 75%; }
  .large-margin-collapse > .xxlarge-10 {
    width: 83.33333%; }
  .large-margin-collapse > .xxlarge-11 {
    width: 91.66667%; }
  .large-margin-collapse > .xxlarge-12 {
    width: 100%; } }

@media screen and (min-width: 120em) {
  .large-margin-collapse > .xxxlarge-1 {
    width: 8.33333%; }
  .large-margin-collapse > .xxxlarge-2 {
    width: 16.66667%; }
  .large-margin-collapse > .xxxlarge-3 {
    width: 25%; }
  .large-margin-collapse > .xxxlarge-4 {
    width: 33.33333%; }
  .large-margin-collapse > .xxxlarge-5 {
    width: 41.66667%; }
  .large-margin-collapse > .xxxlarge-6 {
    width: 50%; }
  .large-margin-collapse > .xxxlarge-7 {
    width: 58.33333%; }
  .large-margin-collapse > .xxxlarge-8 {
    width: 66.66667%; }
  .large-margin-collapse > .xxxlarge-9 {
    width: 75%; }
  .large-margin-collapse > .xxxlarge-10 {
    width: 83.33333%; }
  .large-margin-collapse > .xxxlarge-11 {
    width: 91.66667%; }
  .large-margin-collapse > .xxxlarge-12 {
    width: 100%; } }

@media print, screen and (min-width: 60em) {
  .large-padding-collapse {
    margin-right: 0;
    margin-left: 0; }
    .large-padding-collapse > .cell {
      padding-right: 0;
      padding-left: 0; } }

@media screen and (min-width: 80em) {
  .xlarge-margin-collapse {
    margin-right: 0;
    margin-left: 0; }
    .xlarge-margin-collapse > .cell {
      margin-right: 0;
      margin-left: 0; } }

@media screen and (min-width: 80em) {
  .xlarge-margin-collapse > .small-1 {
    width: 8.33333%; }
  .xlarge-margin-collapse > .small-2 {
    width: 16.66667%; }
  .xlarge-margin-collapse > .small-3 {
    width: 25%; }
  .xlarge-margin-collapse > .small-4 {
    width: 33.33333%; }
  .xlarge-margin-collapse > .small-5 {
    width: 41.66667%; }
  .xlarge-margin-collapse > .small-6 {
    width: 50%; }
  .xlarge-margin-collapse > .small-7 {
    width: 58.33333%; }
  .xlarge-margin-collapse > .small-8 {
    width: 66.66667%; }
  .xlarge-margin-collapse > .small-9 {
    width: 75%; }
  .xlarge-margin-collapse > .small-10 {
    width: 83.33333%; }
  .xlarge-margin-collapse > .small-11 {
    width: 91.66667%; }
  .xlarge-margin-collapse > .small-12 {
    width: 100%; } }

@media screen and (min-width: 80em) {
  .xlarge-margin-collapse > .medium-1 {
    width: 8.33333%; }
  .xlarge-margin-collapse > .medium-2 {
    width: 16.66667%; }
  .xlarge-margin-collapse > .medium-3 {
    width: 25%; }
  .xlarge-margin-collapse > .medium-4 {
    width: 33.33333%; }
  .xlarge-margin-collapse > .medium-5 {
    width: 41.66667%; }
  .xlarge-margin-collapse > .medium-6 {
    width: 50%; }
  .xlarge-margin-collapse > .medium-7 {
    width: 58.33333%; }
  .xlarge-margin-collapse > .medium-8 {
    width: 66.66667%; }
  .xlarge-margin-collapse > .medium-9 {
    width: 75%; }
  .xlarge-margin-collapse > .medium-10 {
    width: 83.33333%; }
  .xlarge-margin-collapse > .medium-11 {
    width: 91.66667%; }
  .xlarge-margin-collapse > .medium-12 {
    width: 100%; } }

@media screen and (min-width: 80em) {
  .xlarge-margin-collapse > .large-1 {
    width: 8.33333%; }
  .xlarge-margin-collapse > .large-2 {
    width: 16.66667%; }
  .xlarge-margin-collapse > .large-3 {
    width: 25%; }
  .xlarge-margin-collapse > .large-4 {
    width: 33.33333%; }
  .xlarge-margin-collapse > .large-5 {
    width: 41.66667%; }
  .xlarge-margin-collapse > .large-6 {
    width: 50%; }
  .xlarge-margin-collapse > .large-7 {
    width: 58.33333%; }
  .xlarge-margin-collapse > .large-8 {
    width: 66.66667%; }
  .xlarge-margin-collapse > .large-9 {
    width: 75%; }
  .xlarge-margin-collapse > .large-10 {
    width: 83.33333%; }
  .xlarge-margin-collapse > .large-11 {
    width: 91.66667%; }
  .xlarge-margin-collapse > .large-12 {
    width: 100%; } }

@media screen and (min-width: 80em) {
  .xlarge-margin-collapse > .xlarge-1 {
    width: 8.33333%; }
  .xlarge-margin-collapse > .xlarge-2 {
    width: 16.66667%; }
  .xlarge-margin-collapse > .xlarge-3 {
    width: 25%; }
  .xlarge-margin-collapse > .xlarge-4 {
    width: 33.33333%; }
  .xlarge-margin-collapse > .xlarge-5 {
    width: 41.66667%; }
  .xlarge-margin-collapse > .xlarge-6 {
    width: 50%; }
  .xlarge-margin-collapse > .xlarge-7 {
    width: 58.33333%; }
  .xlarge-margin-collapse > .xlarge-8 {
    width: 66.66667%; }
  .xlarge-margin-collapse > .xlarge-9 {
    width: 75%; }
  .xlarge-margin-collapse > .xlarge-10 {
    width: 83.33333%; }
  .xlarge-margin-collapse > .xlarge-11 {
    width: 91.66667%; }
  .xlarge-margin-collapse > .xlarge-12 {
    width: 100%; } }

@media screen and (min-width: 100em) {
  .xlarge-margin-collapse > .xxlarge-1 {
    width: 8.33333%; }
  .xlarge-margin-collapse > .xxlarge-2 {
    width: 16.66667%; }
  .xlarge-margin-collapse > .xxlarge-3 {
    width: 25%; }
  .xlarge-margin-collapse > .xxlarge-4 {
    width: 33.33333%; }
  .xlarge-margin-collapse > .xxlarge-5 {
    width: 41.66667%; }
  .xlarge-margin-collapse > .xxlarge-6 {
    width: 50%; }
  .xlarge-margin-collapse > .xxlarge-7 {
    width: 58.33333%; }
  .xlarge-margin-collapse > .xxlarge-8 {
    width: 66.66667%; }
  .xlarge-margin-collapse > .xxlarge-9 {
    width: 75%; }
  .xlarge-margin-collapse > .xxlarge-10 {
    width: 83.33333%; }
  .xlarge-margin-collapse > .xxlarge-11 {
    width: 91.66667%; }
  .xlarge-margin-collapse > .xxlarge-12 {
    width: 100%; } }

@media screen and (min-width: 120em) {
  .xlarge-margin-collapse > .xxxlarge-1 {
    width: 8.33333%; }
  .xlarge-margin-collapse > .xxxlarge-2 {
    width: 16.66667%; }
  .xlarge-margin-collapse > .xxxlarge-3 {
    width: 25%; }
  .xlarge-margin-collapse > .xxxlarge-4 {
    width: 33.33333%; }
  .xlarge-margin-collapse > .xxxlarge-5 {
    width: 41.66667%; }
  .xlarge-margin-collapse > .xxxlarge-6 {
    width: 50%; }
  .xlarge-margin-collapse > .xxxlarge-7 {
    width: 58.33333%; }
  .xlarge-margin-collapse > .xxxlarge-8 {
    width: 66.66667%; }
  .xlarge-margin-collapse > .xxxlarge-9 {
    width: 75%; }
  .xlarge-margin-collapse > .xxxlarge-10 {
    width: 83.33333%; }
  .xlarge-margin-collapse > .xxxlarge-11 {
    width: 91.66667%; }
  .xlarge-margin-collapse > .xxxlarge-12 {
    width: 100%; } }

@media screen and (min-width: 80em) {
  .xlarge-padding-collapse {
    margin-right: 0;
    margin-left: 0; }
    .xlarge-padding-collapse > .cell {
      padding-right: 0;
      padding-left: 0; } }

@media screen and (min-width: 100em) {
  .xxlarge-margin-collapse {
    margin-right: 0;
    margin-left: 0; }
    .xxlarge-margin-collapse > .cell {
      margin-right: 0;
      margin-left: 0; } }

@media screen and (min-width: 100em) {
  .xxlarge-margin-collapse > .small-1 {
    width: 8.33333%; }
  .xxlarge-margin-collapse > .small-2 {
    width: 16.66667%; }
  .xxlarge-margin-collapse > .small-3 {
    width: 25%; }
  .xxlarge-margin-collapse > .small-4 {
    width: 33.33333%; }
  .xxlarge-margin-collapse > .small-5 {
    width: 41.66667%; }
  .xxlarge-margin-collapse > .small-6 {
    width: 50%; }
  .xxlarge-margin-collapse > .small-7 {
    width: 58.33333%; }
  .xxlarge-margin-collapse > .small-8 {
    width: 66.66667%; }
  .xxlarge-margin-collapse > .small-9 {
    width: 75%; }
  .xxlarge-margin-collapse > .small-10 {
    width: 83.33333%; }
  .xxlarge-margin-collapse > .small-11 {
    width: 91.66667%; }
  .xxlarge-margin-collapse > .small-12 {
    width: 100%; } }

@media screen and (min-width: 100em) {
  .xxlarge-margin-collapse > .medium-1 {
    width: 8.33333%; }
  .xxlarge-margin-collapse > .medium-2 {
    width: 16.66667%; }
  .xxlarge-margin-collapse > .medium-3 {
    width: 25%; }
  .xxlarge-margin-collapse > .medium-4 {
    width: 33.33333%; }
  .xxlarge-margin-collapse > .medium-5 {
    width: 41.66667%; }
  .xxlarge-margin-collapse > .medium-6 {
    width: 50%; }
  .xxlarge-margin-collapse > .medium-7 {
    width: 58.33333%; }
  .xxlarge-margin-collapse > .medium-8 {
    width: 66.66667%; }
  .xxlarge-margin-collapse > .medium-9 {
    width: 75%; }
  .xxlarge-margin-collapse > .medium-10 {
    width: 83.33333%; }
  .xxlarge-margin-collapse > .medium-11 {
    width: 91.66667%; }
  .xxlarge-margin-collapse > .medium-12 {
    width: 100%; } }

@media screen and (min-width: 100em) {
  .xxlarge-margin-collapse > .large-1 {
    width: 8.33333%; }
  .xxlarge-margin-collapse > .large-2 {
    width: 16.66667%; }
  .xxlarge-margin-collapse > .large-3 {
    width: 25%; }
  .xxlarge-margin-collapse > .large-4 {
    width: 33.33333%; }
  .xxlarge-margin-collapse > .large-5 {
    width: 41.66667%; }
  .xxlarge-margin-collapse > .large-6 {
    width: 50%; }
  .xxlarge-margin-collapse > .large-7 {
    width: 58.33333%; }
  .xxlarge-margin-collapse > .large-8 {
    width: 66.66667%; }
  .xxlarge-margin-collapse > .large-9 {
    width: 75%; }
  .xxlarge-margin-collapse > .large-10 {
    width: 83.33333%; }
  .xxlarge-margin-collapse > .large-11 {
    width: 91.66667%; }
  .xxlarge-margin-collapse > .large-12 {
    width: 100%; } }

@media screen and (min-width: 100em) {
  .xxlarge-margin-collapse > .xlarge-1 {
    width: 8.33333%; }
  .xxlarge-margin-collapse > .xlarge-2 {
    width: 16.66667%; }
  .xxlarge-margin-collapse > .xlarge-3 {
    width: 25%; }
  .xxlarge-margin-collapse > .xlarge-4 {
    width: 33.33333%; }
  .xxlarge-margin-collapse > .xlarge-5 {
    width: 41.66667%; }
  .xxlarge-margin-collapse > .xlarge-6 {
    width: 50%; }
  .xxlarge-margin-collapse > .xlarge-7 {
    width: 58.33333%; }
  .xxlarge-margin-collapse > .xlarge-8 {
    width: 66.66667%; }
  .xxlarge-margin-collapse > .xlarge-9 {
    width: 75%; }
  .xxlarge-margin-collapse > .xlarge-10 {
    width: 83.33333%; }
  .xxlarge-margin-collapse > .xlarge-11 {
    width: 91.66667%; }
  .xxlarge-margin-collapse > .xlarge-12 {
    width: 100%; } }

@media screen and (min-width: 100em) {
  .xxlarge-margin-collapse > .xxlarge-1 {
    width: 8.33333%; }
  .xxlarge-margin-collapse > .xxlarge-2 {
    width: 16.66667%; }
  .xxlarge-margin-collapse > .xxlarge-3 {
    width: 25%; }
  .xxlarge-margin-collapse > .xxlarge-4 {
    width: 33.33333%; }
  .xxlarge-margin-collapse > .xxlarge-5 {
    width: 41.66667%; }
  .xxlarge-margin-collapse > .xxlarge-6 {
    width: 50%; }
  .xxlarge-margin-collapse > .xxlarge-7 {
    width: 58.33333%; }
  .xxlarge-margin-collapse > .xxlarge-8 {
    width: 66.66667%; }
  .xxlarge-margin-collapse > .xxlarge-9 {
    width: 75%; }
  .xxlarge-margin-collapse > .xxlarge-10 {
    width: 83.33333%; }
  .xxlarge-margin-collapse > .xxlarge-11 {
    width: 91.66667%; }
  .xxlarge-margin-collapse > .xxlarge-12 {
    width: 100%; } }

@media screen and (min-width: 120em) {
  .xxlarge-margin-collapse > .xxxlarge-1 {
    width: 8.33333%; }
  .xxlarge-margin-collapse > .xxxlarge-2 {
    width: 16.66667%; }
  .xxlarge-margin-collapse > .xxxlarge-3 {
    width: 25%; }
  .xxlarge-margin-collapse > .xxxlarge-4 {
    width: 33.33333%; }
  .xxlarge-margin-collapse > .xxxlarge-5 {
    width: 41.66667%; }
  .xxlarge-margin-collapse > .xxxlarge-6 {
    width: 50%; }
  .xxlarge-margin-collapse > .xxxlarge-7 {
    width: 58.33333%; }
  .xxlarge-margin-collapse > .xxxlarge-8 {
    width: 66.66667%; }
  .xxlarge-margin-collapse > .xxxlarge-9 {
    width: 75%; }
  .xxlarge-margin-collapse > .xxxlarge-10 {
    width: 83.33333%; }
  .xxlarge-margin-collapse > .xxxlarge-11 {
    width: 91.66667%; }
  .xxlarge-margin-collapse > .xxxlarge-12 {
    width: 100%; } }

@media screen and (min-width: 100em) {
  .xxlarge-padding-collapse {
    margin-right: 0;
    margin-left: 0; }
    .xxlarge-padding-collapse > .cell {
      padding-right: 0;
      padding-left: 0; } }

@media screen and (min-width: 120em) {
  .xxxlarge-margin-collapse {
    margin-right: 0;
    margin-left: 0; }
    .xxxlarge-margin-collapse > .cell {
      margin-right: 0;
      margin-left: 0; } }

@media screen and (min-width: 120em) {
  .xxxlarge-margin-collapse > .small-1 {
    width: 8.33333%; }
  .xxxlarge-margin-collapse > .small-2 {
    width: 16.66667%; }
  .xxxlarge-margin-collapse > .small-3 {
    width: 25%; }
  .xxxlarge-margin-collapse > .small-4 {
    width: 33.33333%; }
  .xxxlarge-margin-collapse > .small-5 {
    width: 41.66667%; }
  .xxxlarge-margin-collapse > .small-6 {
    width: 50%; }
  .xxxlarge-margin-collapse > .small-7 {
    width: 58.33333%; }
  .xxxlarge-margin-collapse > .small-8 {
    width: 66.66667%; }
  .xxxlarge-margin-collapse > .small-9 {
    width: 75%; }
  .xxxlarge-margin-collapse > .small-10 {
    width: 83.33333%; }
  .xxxlarge-margin-collapse > .small-11 {
    width: 91.66667%; }
  .xxxlarge-margin-collapse > .small-12 {
    width: 100%; } }

@media screen and (min-width: 120em) {
  .xxxlarge-margin-collapse > .medium-1 {
    width: 8.33333%; }
  .xxxlarge-margin-collapse > .medium-2 {
    width: 16.66667%; }
  .xxxlarge-margin-collapse > .medium-3 {
    width: 25%; }
  .xxxlarge-margin-collapse > .medium-4 {
    width: 33.33333%; }
  .xxxlarge-margin-collapse > .medium-5 {
    width: 41.66667%; }
  .xxxlarge-margin-collapse > .medium-6 {
    width: 50%; }
  .xxxlarge-margin-collapse > .medium-7 {
    width: 58.33333%; }
  .xxxlarge-margin-collapse > .medium-8 {
    width: 66.66667%; }
  .xxxlarge-margin-collapse > .medium-9 {
    width: 75%; }
  .xxxlarge-margin-collapse > .medium-10 {
    width: 83.33333%; }
  .xxxlarge-margin-collapse > .medium-11 {
    width: 91.66667%; }
  .xxxlarge-margin-collapse > .medium-12 {
    width: 100%; } }

@media screen and (min-width: 120em) {
  .xxxlarge-margin-collapse > .large-1 {
    width: 8.33333%; }
  .xxxlarge-margin-collapse > .large-2 {
    width: 16.66667%; }
  .xxxlarge-margin-collapse > .large-3 {
    width: 25%; }
  .xxxlarge-margin-collapse > .large-4 {
    width: 33.33333%; }
  .xxxlarge-margin-collapse > .large-5 {
    width: 41.66667%; }
  .xxxlarge-margin-collapse > .large-6 {
    width: 50%; }
  .xxxlarge-margin-collapse > .large-7 {
    width: 58.33333%; }
  .xxxlarge-margin-collapse > .large-8 {
    width: 66.66667%; }
  .xxxlarge-margin-collapse > .large-9 {
    width: 75%; }
  .xxxlarge-margin-collapse > .large-10 {
    width: 83.33333%; }
  .xxxlarge-margin-collapse > .large-11 {
    width: 91.66667%; }
  .xxxlarge-margin-collapse > .large-12 {
    width: 100%; } }

@media screen and (min-width: 120em) {
  .xxxlarge-margin-collapse > .xlarge-1 {
    width: 8.33333%; }
  .xxxlarge-margin-collapse > .xlarge-2 {
    width: 16.66667%; }
  .xxxlarge-margin-collapse > .xlarge-3 {
    width: 25%; }
  .xxxlarge-margin-collapse > .xlarge-4 {
    width: 33.33333%; }
  .xxxlarge-margin-collapse > .xlarge-5 {
    width: 41.66667%; }
  .xxxlarge-margin-collapse > .xlarge-6 {
    width: 50%; }
  .xxxlarge-margin-collapse > .xlarge-7 {
    width: 58.33333%; }
  .xxxlarge-margin-collapse > .xlarge-8 {
    width: 66.66667%; }
  .xxxlarge-margin-collapse > .xlarge-9 {
    width: 75%; }
  .xxxlarge-margin-collapse > .xlarge-10 {
    width: 83.33333%; }
  .xxxlarge-margin-collapse > .xlarge-11 {
    width: 91.66667%; }
  .xxxlarge-margin-collapse > .xlarge-12 {
    width: 100%; } }

@media screen and (min-width: 120em) {
  .xxxlarge-margin-collapse > .xxlarge-1 {
    width: 8.33333%; }
  .xxxlarge-margin-collapse > .xxlarge-2 {
    width: 16.66667%; }
  .xxxlarge-margin-collapse > .xxlarge-3 {
    width: 25%; }
  .xxxlarge-margin-collapse > .xxlarge-4 {
    width: 33.33333%; }
  .xxxlarge-margin-collapse > .xxlarge-5 {
    width: 41.66667%; }
  .xxxlarge-margin-collapse > .xxlarge-6 {
    width: 50%; }
  .xxxlarge-margin-collapse > .xxlarge-7 {
    width: 58.33333%; }
  .xxxlarge-margin-collapse > .xxlarge-8 {
    width: 66.66667%; }
  .xxxlarge-margin-collapse > .xxlarge-9 {
    width: 75%; }
  .xxxlarge-margin-collapse > .xxlarge-10 {
    width: 83.33333%; }
  .xxxlarge-margin-collapse > .xxlarge-11 {
    width: 91.66667%; }
  .xxxlarge-margin-collapse > .xxlarge-12 {
    width: 100%; } }

@media screen and (min-width: 120em) {
  .xxxlarge-margin-collapse > .xxxlarge-1 {
    width: 8.33333%; }
  .xxxlarge-margin-collapse > .xxxlarge-2 {
    width: 16.66667%; }
  .xxxlarge-margin-collapse > .xxxlarge-3 {
    width: 25%; }
  .xxxlarge-margin-collapse > .xxxlarge-4 {
    width: 33.33333%; }
  .xxxlarge-margin-collapse > .xxxlarge-5 {
    width: 41.66667%; }
  .xxxlarge-margin-collapse > .xxxlarge-6 {
    width: 50%; }
  .xxxlarge-margin-collapse > .xxxlarge-7 {
    width: 58.33333%; }
  .xxxlarge-margin-collapse > .xxxlarge-8 {
    width: 66.66667%; }
  .xxxlarge-margin-collapse > .xxxlarge-9 {
    width: 75%; }
  .xxxlarge-margin-collapse > .xxxlarge-10 {
    width: 83.33333%; }
  .xxxlarge-margin-collapse > .xxxlarge-11 {
    width: 91.66667%; }
  .xxxlarge-margin-collapse > .xxxlarge-12 {
    width: 100%; } }

@media screen and (min-width: 120em) {
  .xxxlarge-padding-collapse {
    margin-right: 0;
    margin-left: 0; }
    .xxxlarge-padding-collapse > .cell {
      padding-right: 0;
      padding-left: 0; } }

.small-offset-0 {
  margin-left: 0%; }

.grid-margin-x > .small-offset-0 {
  margin-left: calc(0% + 0.875rem); }

.small-offset-1 {
  margin-left: 8.33333%; }

.grid-margin-x > .small-offset-1 {
  margin-left: calc(8.33333% + 0.875rem); }

.small-offset-2 {
  margin-left: 16.66667%; }

.grid-margin-x > .small-offset-2 {
  margin-left: calc(16.66667% + 0.875rem); }

.small-offset-3 {
  margin-left: 25%; }

.grid-margin-x > .small-offset-3 {
  margin-left: calc(25% + 0.875rem); }

.small-offset-4 {
  margin-left: 33.33333%; }

.grid-margin-x > .small-offset-4 {
  margin-left: calc(33.33333% + 0.875rem); }

.small-offset-5 {
  margin-left: 41.66667%; }

.grid-margin-x > .small-offset-5 {
  margin-left: calc(41.66667% + 0.875rem); }

.small-offset-6 {
  margin-left: 50%; }

.grid-margin-x > .small-offset-6 {
  margin-left: calc(50% + 0.875rem); }

.small-offset-7 {
  margin-left: 58.33333%; }

.grid-margin-x > .small-offset-7 {
  margin-left: calc(58.33333% + 0.875rem); }

.small-offset-8 {
  margin-left: 66.66667%; }

.grid-margin-x > .small-offset-8 {
  margin-left: calc(66.66667% + 0.875rem); }

.small-offset-9 {
  margin-left: 75%; }

.grid-margin-x > .small-offset-9 {
  margin-left: calc(75% + 0.875rem); }

.small-offset-10 {
  margin-left: 83.33333%; }

.grid-margin-x > .small-offset-10 {
  margin-left: calc(83.33333% + 0.875rem); }

.small-offset-11 {
  margin-left: 91.66667%; }

.grid-margin-x > .small-offset-11 {
  margin-left: calc(91.66667% + 0.875rem); }

@media print, screen and (min-width: 40em) {
  .medium-offset-0 {
    margin-left: 0%; }
  .grid-margin-x > .medium-offset-0 {
    margin-left: calc(0% + 0.875rem); }
  .medium-offset-1 {
    margin-left: 8.33333%; }
  .grid-margin-x > .medium-offset-1 {
    margin-left: calc(8.33333% + 0.875rem); }
  .medium-offset-2 {
    margin-left: 16.66667%; }
  .grid-margin-x > .medium-offset-2 {
    margin-left: calc(16.66667% + 0.875rem); }
  .medium-offset-3 {
    margin-left: 25%; }
  .grid-margin-x > .medium-offset-3 {
    margin-left: calc(25% + 0.875rem); }
  .medium-offset-4 {
    margin-left: 33.33333%; }
  .grid-margin-x > .medium-offset-4 {
    margin-left: calc(33.33333% + 0.875rem); }
  .medium-offset-5 {
    margin-left: 41.66667%; }
  .grid-margin-x > .medium-offset-5 {
    margin-left: calc(41.66667% + 0.875rem); }
  .medium-offset-6 {
    margin-left: 50%; }
  .grid-margin-x > .medium-offset-6 {
    margin-left: calc(50% + 0.875rem); }
  .medium-offset-7 {
    margin-left: 58.33333%; }
  .grid-margin-x > .medium-offset-7 {
    margin-left: calc(58.33333% + 0.875rem); }
  .medium-offset-8 {
    margin-left: 66.66667%; }
  .grid-margin-x > .medium-offset-8 {
    margin-left: calc(66.66667% + 0.875rem); }
  .medium-offset-9 {
    margin-left: 75%; }
  .grid-margin-x > .medium-offset-9 {
    margin-left: calc(75% + 0.875rem); }
  .medium-offset-10 {
    margin-left: 83.33333%; }
  .grid-margin-x > .medium-offset-10 {
    margin-left: calc(83.33333% + 0.875rem); }
  .medium-offset-11 {
    margin-left: 91.66667%; }
  .grid-margin-x > .medium-offset-11 {
    margin-left: calc(91.66667% + 0.875rem); } }

@media print, screen and (min-width: 60em) {
  .large-offset-0 {
    margin-left: 0%; }
  .grid-margin-x > .large-offset-0 {
    margin-left: calc(0% + 0.875rem); }
  .large-offset-1 {
    margin-left: 8.33333%; }
  .grid-margin-x > .large-offset-1 {
    margin-left: calc(8.33333% + 0.875rem); }
  .large-offset-2 {
    margin-left: 16.66667%; }
  .grid-margin-x > .large-offset-2 {
    margin-left: calc(16.66667% + 0.875rem); }
  .large-offset-3 {
    margin-left: 25%; }
  .grid-margin-x > .large-offset-3 {
    margin-left: calc(25% + 0.875rem); }
  .large-offset-4 {
    margin-left: 33.33333%; }
  .grid-margin-x > .large-offset-4 {
    margin-left: calc(33.33333% + 0.875rem); }
  .large-offset-5 {
    margin-left: 41.66667%; }
  .grid-margin-x > .large-offset-5 {
    margin-left: calc(41.66667% + 0.875rem); }
  .large-offset-6 {
    margin-left: 50%; }
  .grid-margin-x > .large-offset-6 {
    margin-left: calc(50% + 0.875rem); }
  .large-offset-7 {
    margin-left: 58.33333%; }
  .grid-margin-x > .large-offset-7 {
    margin-left: calc(58.33333% + 0.875rem); }
  .large-offset-8 {
    margin-left: 66.66667%; }
  .grid-margin-x > .large-offset-8 {
    margin-left: calc(66.66667% + 0.875rem); }
  .large-offset-9 {
    margin-left: 75%; }
  .grid-margin-x > .large-offset-9 {
    margin-left: calc(75% + 0.875rem); }
  .large-offset-10 {
    margin-left: 83.33333%; }
  .grid-margin-x > .large-offset-10 {
    margin-left: calc(83.33333% + 0.875rem); }
  .large-offset-11 {
    margin-left: 91.66667%; }
  .grid-margin-x > .large-offset-11 {
    margin-left: calc(91.66667% + 0.875rem); } }

@media screen and (min-width: 80em) {
  .xlarge-offset-0 {
    margin-left: 0%; }
  .grid-margin-x > .xlarge-offset-0 {
    margin-left: calc(0% + 0.875rem); }
  .xlarge-offset-1 {
    margin-left: 8.33333%; }
  .grid-margin-x > .xlarge-offset-1 {
    margin-left: calc(8.33333% + 0.875rem); }
  .xlarge-offset-2 {
    margin-left: 16.66667%; }
  .grid-margin-x > .xlarge-offset-2 {
    margin-left: calc(16.66667% + 0.875rem); }
  .xlarge-offset-3 {
    margin-left: 25%; }
  .grid-margin-x > .xlarge-offset-3 {
    margin-left: calc(25% + 0.875rem); }
  .xlarge-offset-4 {
    margin-left: 33.33333%; }
  .grid-margin-x > .xlarge-offset-4 {
    margin-left: calc(33.33333% + 0.875rem); }
  .xlarge-offset-5 {
    margin-left: 41.66667%; }
  .grid-margin-x > .xlarge-offset-5 {
    margin-left: calc(41.66667% + 0.875rem); }
  .xlarge-offset-6 {
    margin-left: 50%; }
  .grid-margin-x > .xlarge-offset-6 {
    margin-left: calc(50% + 0.875rem); }
  .xlarge-offset-7 {
    margin-left: 58.33333%; }
  .grid-margin-x > .xlarge-offset-7 {
    margin-left: calc(58.33333% + 0.875rem); }
  .xlarge-offset-8 {
    margin-left: 66.66667%; }
  .grid-margin-x > .xlarge-offset-8 {
    margin-left: calc(66.66667% + 0.875rem); }
  .xlarge-offset-9 {
    margin-left: 75%; }
  .grid-margin-x > .xlarge-offset-9 {
    margin-left: calc(75% + 0.875rem); }
  .xlarge-offset-10 {
    margin-left: 83.33333%; }
  .grid-margin-x > .xlarge-offset-10 {
    margin-left: calc(83.33333% + 0.875rem); }
  .xlarge-offset-11 {
    margin-left: 91.66667%; }
  .grid-margin-x > .xlarge-offset-11 {
    margin-left: calc(91.66667% + 0.875rem); } }

@media screen and (min-width: 100em) {
  .xxlarge-offset-0 {
    margin-left: 0%; }
  .grid-margin-x > .xxlarge-offset-0 {
    margin-left: calc(0% + 0.875rem); }
  .xxlarge-offset-1 {
    margin-left: 8.33333%; }
  .grid-margin-x > .xxlarge-offset-1 {
    margin-left: calc(8.33333% + 0.875rem); }
  .xxlarge-offset-2 {
    margin-left: 16.66667%; }
  .grid-margin-x > .xxlarge-offset-2 {
    margin-left: calc(16.66667% + 0.875rem); }
  .xxlarge-offset-3 {
    margin-left: 25%; }
  .grid-margin-x > .xxlarge-offset-3 {
    margin-left: calc(25% + 0.875rem); }
  .xxlarge-offset-4 {
    margin-left: 33.33333%; }
  .grid-margin-x > .xxlarge-offset-4 {
    margin-left: calc(33.33333% + 0.875rem); }
  .xxlarge-offset-5 {
    margin-left: 41.66667%; }
  .grid-margin-x > .xxlarge-offset-5 {
    margin-left: calc(41.66667% + 0.875rem); }
  .xxlarge-offset-6 {
    margin-left: 50%; }
  .grid-margin-x > .xxlarge-offset-6 {
    margin-left: calc(50% + 0.875rem); }
  .xxlarge-offset-7 {
    margin-left: 58.33333%; }
  .grid-margin-x > .xxlarge-offset-7 {
    margin-left: calc(58.33333% + 0.875rem); }
  .xxlarge-offset-8 {
    margin-left: 66.66667%; }
  .grid-margin-x > .xxlarge-offset-8 {
    margin-left: calc(66.66667% + 0.875rem); }
  .xxlarge-offset-9 {
    margin-left: 75%; }
  .grid-margin-x > .xxlarge-offset-9 {
    margin-left: calc(75% + 0.875rem); }
  .xxlarge-offset-10 {
    margin-left: 83.33333%; }
  .grid-margin-x > .xxlarge-offset-10 {
    margin-left: calc(83.33333% + 0.875rem); }
  .xxlarge-offset-11 {
    margin-left: 91.66667%; }
  .grid-margin-x > .xxlarge-offset-11 {
    margin-left: calc(91.66667% + 0.875rem); } }

@media screen and (min-width: 120em) {
  .xxxlarge-offset-0 {
    margin-left: 0%; }
  .grid-margin-x > .xxxlarge-offset-0 {
    margin-left: calc(0% + 0.875rem); }
  .xxxlarge-offset-1 {
    margin-left: 8.33333%; }
  .grid-margin-x > .xxxlarge-offset-1 {
    margin-left: calc(8.33333% + 0.875rem); }
  .xxxlarge-offset-2 {
    margin-left: 16.66667%; }
  .grid-margin-x > .xxxlarge-offset-2 {
    margin-left: calc(16.66667% + 0.875rem); }
  .xxxlarge-offset-3 {
    margin-left: 25%; }
  .grid-margin-x > .xxxlarge-offset-3 {
    margin-left: calc(25% + 0.875rem); }
  .xxxlarge-offset-4 {
    margin-left: 33.33333%; }
  .grid-margin-x > .xxxlarge-offset-4 {
    margin-left: calc(33.33333% + 0.875rem); }
  .xxxlarge-offset-5 {
    margin-left: 41.66667%; }
  .grid-margin-x > .xxxlarge-offset-5 {
    margin-left: calc(41.66667% + 0.875rem); }
  .xxxlarge-offset-6 {
    margin-left: 50%; }
  .grid-margin-x > .xxxlarge-offset-6 {
    margin-left: calc(50% + 0.875rem); }
  .xxxlarge-offset-7 {
    margin-left: 58.33333%; }
  .grid-margin-x > .xxxlarge-offset-7 {
    margin-left: calc(58.33333% + 0.875rem); }
  .xxxlarge-offset-8 {
    margin-left: 66.66667%; }
  .grid-margin-x > .xxxlarge-offset-8 {
    margin-left: calc(66.66667% + 0.875rem); }
  .xxxlarge-offset-9 {
    margin-left: 75%; }
  .grid-margin-x > .xxxlarge-offset-9 {
    margin-left: calc(75% + 0.875rem); }
  .xxxlarge-offset-10 {
    margin-left: 83.33333%; }
  .grid-margin-x > .xxxlarge-offset-10 {
    margin-left: calc(83.33333% + 0.875rem); }
  .xxxlarge-offset-11 {
    margin-left: 91.66667%; }
  .grid-margin-x > .xxxlarge-offset-11 {
    margin-left: calc(91.66667% + 0.875rem); } }

.grid-y {
  display: -ms-flexbox;
  display: flex;
  -ms-flex-flow: column nowrap;
      flex-flow: column nowrap; }
  .grid-y > .cell {
    height: auto;
    max-height: none; }
  .grid-y > .auto {
    height: auto; }
  .grid-y > .shrink {
    height: auto; }
  .grid-y > .small-shrink, .grid-y > .small-full, .grid-y > .small-1, .grid-y > .small-2, .grid-y > .small-3, .grid-y > .small-4, .grid-y > .small-5, .grid-y > .small-6, .grid-y > .small-7, .grid-y > .small-8, .grid-y > .small-9, .grid-y > .small-10, .grid-y > .small-11, .grid-y > .small-12 {
    -ms-flex-preferred-size: auto;
        flex-basis: auto; }
  @media print, screen and (min-width: 40em) {
    .grid-y > .medium-shrink, .grid-y > .medium-full, .grid-y > .medium-1, .grid-y > .medium-2, .grid-y > .medium-3, .grid-y > .medium-4, .grid-y > .medium-5, .grid-y > .medium-6, .grid-y > .medium-7, .grid-y > .medium-8, .grid-y > .medium-9, .grid-y > .medium-10, .grid-y > .medium-11, .grid-y > .medium-12 {
      -ms-flex-preferred-size: auto;
          flex-basis: auto; } }
  @media print, screen and (min-width: 60em) {
    .grid-y > .large-shrink, .grid-y > .large-full, .grid-y > .large-1, .grid-y > .large-2, .grid-y > .large-3, .grid-y > .large-4, .grid-y > .large-5, .grid-y > .large-6, .grid-y > .large-7, .grid-y > .large-8, .grid-y > .large-9, .grid-y > .large-10, .grid-y > .large-11, .grid-y > .large-12 {
      -ms-flex-preferred-size: auto;
          flex-basis: auto; } }
  @media screen and (min-width: 80em) {
    .grid-y > .xlarge-shrink, .grid-y > .xlarge-full, .grid-y > .xlarge-1, .grid-y > .xlarge-2, .grid-y > .xlarge-3, .grid-y > .xlarge-4, .grid-y > .xlarge-5, .grid-y > .xlarge-6, .grid-y > .xlarge-7, .grid-y > .xlarge-8, .grid-y > .xlarge-9, .grid-y > .xlarge-10, .grid-y > .xlarge-11, .grid-y > .xlarge-12 {
      -ms-flex-preferred-size: auto;
          flex-basis: auto; } }
  @media screen and (min-width: 100em) {
    .grid-y > .xxlarge-shrink, .grid-y > .xxlarge-full, .grid-y > .xxlarge-1, .grid-y > .xxlarge-2, .grid-y > .xxlarge-3, .grid-y > .xxlarge-4, .grid-y > .xxlarge-5, .grid-y > .xxlarge-6, .grid-y > .xxlarge-7, .grid-y > .xxlarge-8, .grid-y > .xxlarge-9, .grid-y > .xxlarge-10, .grid-y > .xxlarge-11, .grid-y > .xxlarge-12 {
      -ms-flex-preferred-size: auto;
          flex-basis: auto; } }
  @media screen and (min-width: 120em) {
    .grid-y > .xxxlarge-shrink, .grid-y > .xxxlarge-full, .grid-y > .xxxlarge-1, .grid-y > .xxxlarge-2, .grid-y > .xxxlarge-3, .grid-y > .xxxlarge-4, .grid-y > .xxxlarge-5, .grid-y > .xxxlarge-6, .grid-y > .xxxlarge-7, .grid-y > .xxxlarge-8, .grid-y > .xxxlarge-9, .grid-y > .xxxlarge-10, .grid-y > .xxxlarge-11, .grid-y > .xxxlarge-12 {
      -ms-flex-preferred-size: auto;
          flex-basis: auto; } }
  .grid-y > .small-1, .grid-y > .small-2, .grid-y > .small-3, .grid-y > .small-4, .grid-y > .small-5, .grid-y > .small-6, .grid-y > .small-7, .grid-y > .small-8, .grid-y > .small-9, .grid-y > .small-10, .grid-y > .small-11, .grid-y > .small-12 {
    -ms-flex: 0 0 auto;
        flex: 0 0 auto; }
  .grid-y > .small-1 {
    height: 8.33333%; }
  .grid-y > .small-2 {
    height: 16.66667%; }
  .grid-y > .small-3 {
    height: 25%; }
  .grid-y > .small-4 {
    height: 33.33333%; }
  .grid-y > .small-5 {
    height: 41.66667%; }
  .grid-y > .small-6 {
    height: 50%; }
  .grid-y > .small-7 {
    height: 58.33333%; }
  .grid-y > .small-8 {
    height: 66.66667%; }
  .grid-y > .small-9 {
    height: 75%; }
  .grid-y > .small-10 {
    height: 83.33333%; }
  .grid-y > .small-11 {
    height: 91.66667%; }
  .grid-y > .small-12 {
    height: 100%; }
  @media print, screen and (min-width: 40em) {
    .grid-y > .medium-auto {
      -ms-flex: 1 1 0px;
          flex: 1 1 0px;
      height: auto; }
    .grid-y > .medium-shrink, .grid-y > .medium-1, .grid-y > .medium-2, .grid-y > .medium-3, .grid-y > .medium-4, .grid-y > .medium-5, .grid-y > .medium-6, .grid-y > .medium-7, .grid-y > .medium-8, .grid-y > .medium-9, .grid-y > .medium-10, .grid-y > .medium-11, .grid-y > .medium-12 {
      -ms-flex: 0 0 auto;
          flex: 0 0 auto; }
    .grid-y > .medium-shrink {
      height: auto; }
    .grid-y > .medium-1 {
      height: 8.33333%; }
    .grid-y > .medium-2 {
      height: 16.66667%; }
    .grid-y > .medium-3 {
      height: 25%; }
    .grid-y > .medium-4 {
      height: 33.33333%; }
    .grid-y > .medium-5 {
      height: 41.66667%; }
    .grid-y > .medium-6 {
      height: 50%; }
    .grid-y > .medium-7 {
      height: 58.33333%; }
    .grid-y > .medium-8 {
      height: 66.66667%; }
    .grid-y > .medium-9 {
      height: 75%; }
    .grid-y > .medium-10 {
      height: 83.33333%; }
    .grid-y > .medium-11 {
      height: 91.66667%; }
    .grid-y > .medium-12 {
      height: 100%; } }
  @media print, screen and (min-width: 60em) {
    .grid-y > .large-auto {
      -ms-flex: 1 1 0px;
          flex: 1 1 0px;
      height: auto; }
    .grid-y > .large-shrink, .grid-y > .large-1, .grid-y > .large-2, .grid-y > .large-3, .grid-y > .large-4, .grid-y > .large-5, .grid-y > .large-6, .grid-y > .large-7, .grid-y > .large-8, .grid-y > .large-9, .grid-y > .large-10, .grid-y > .large-11, .grid-y > .large-12 {
      -ms-flex: 0 0 auto;
          flex: 0 0 auto; }
    .grid-y > .large-shrink {
      height: auto; }
    .grid-y > .large-1 {
      height: 8.33333%; }
    .grid-y > .large-2 {
      height: 16.66667%; }
    .grid-y > .large-3 {
      height: 25%; }
    .grid-y > .large-4 {
      height: 33.33333%; }
    .grid-y > .large-5 {
      height: 41.66667%; }
    .grid-y > .large-6 {
      height: 50%; }
    .grid-y > .large-7 {
      height: 58.33333%; }
    .grid-y > .large-8 {
      height: 66.66667%; }
    .grid-y > .large-9 {
      height: 75%; }
    .grid-y > .large-10 {
      height: 83.33333%; }
    .grid-y > .large-11 {
      height: 91.66667%; }
    .grid-y > .large-12 {
      height: 100%; } }
  @media screen and (min-width: 80em) {
    .grid-y > .xlarge-auto {
      -ms-flex: 1 1 0px;
          flex: 1 1 0px;
      height: auto; }
    .grid-y > .xlarge-shrink, .grid-y > .xlarge-1, .grid-y > .xlarge-2, .grid-y > .xlarge-3, .grid-y > .xlarge-4, .grid-y > .xlarge-5, .grid-y > .xlarge-6, .grid-y > .xlarge-7, .grid-y > .xlarge-8, .grid-y > .xlarge-9, .grid-y > .xlarge-10, .grid-y > .xlarge-11, .grid-y > .xlarge-12 {
      -ms-flex: 0 0 auto;
          flex: 0 0 auto; }
    .grid-y > .xlarge-shrink {
      height: auto; }
    .grid-y > .xlarge-1 {
      height: 8.33333%; }
    .grid-y > .xlarge-2 {
      height: 16.66667%; }
    .grid-y > .xlarge-3 {
      height: 25%; }
    .grid-y > .xlarge-4 {
      height: 33.33333%; }
    .grid-y > .xlarge-5 {
      height: 41.66667%; }
    .grid-y > .xlarge-6 {
      height: 50%; }
    .grid-y > .xlarge-7 {
      height: 58.33333%; }
    .grid-y > .xlarge-8 {
      height: 66.66667%; }
    .grid-y > .xlarge-9 {
      height: 75%; }
    .grid-y > .xlarge-10 {
      height: 83.33333%; }
    .grid-y > .xlarge-11 {
      height: 91.66667%; }
    .grid-y > .xlarge-12 {
      height: 100%; } }
  @media screen and (min-width: 100em) {
    .grid-y > .xxlarge-auto {
      -ms-flex: 1 1 0px;
          flex: 1 1 0px;
      height: auto; }
    .grid-y > .xxlarge-shrink, .grid-y > .xxlarge-1, .grid-y > .xxlarge-2, .grid-y > .xxlarge-3, .grid-y > .xxlarge-4, .grid-y > .xxlarge-5, .grid-y > .xxlarge-6, .grid-y > .xxlarge-7, .grid-y > .xxlarge-8, .grid-y > .xxlarge-9, .grid-y > .xxlarge-10, .grid-y > .xxlarge-11, .grid-y > .xxlarge-12 {
      -ms-flex: 0 0 auto;
          flex: 0 0 auto; }
    .grid-y > .xxlarge-shrink {
      height: auto; }
    .grid-y > .xxlarge-1 {
      height: 8.33333%; }
    .grid-y > .xxlarge-2 {
      height: 16.66667%; }
    .grid-y > .xxlarge-3 {
      height: 25%; }
    .grid-y > .xxlarge-4 {
      height: 33.33333%; }
    .grid-y > .xxlarge-5 {
      height: 41.66667%; }
    .grid-y > .xxlarge-6 {
      height: 50%; }
    .grid-y > .xxlarge-7 {
      height: 58.33333%; }
    .grid-y > .xxlarge-8 {
      height: 66.66667%; }
    .grid-y > .xxlarge-9 {
      height: 75%; }
    .grid-y > .xxlarge-10 {
      height: 83.33333%; }
    .grid-y > .xxlarge-11 {
      height: 91.66667%; }
    .grid-y > .xxlarge-12 {
      height: 100%; } }
  @media screen and (min-width: 120em) {
    .grid-y > .xxxlarge-auto {
      -ms-flex: 1 1 0px;
          flex: 1 1 0px;
      height: auto; }
    .grid-y > .xxxlarge-shrink, .grid-y > .xxxlarge-1, .grid-y > .xxxlarge-2, .grid-y > .xxxlarge-3, .grid-y > .xxxlarge-4, .grid-y > .xxxlarge-5, .grid-y > .xxxlarge-6, .grid-y > .xxxlarge-7, .grid-y > .xxxlarge-8, .grid-y > .xxxlarge-9, .grid-y > .xxxlarge-10, .grid-y > .xxxlarge-11, .grid-y > .xxxlarge-12 {
      -ms-flex: 0 0 auto;
          flex: 0 0 auto; }
    .grid-y > .xxxlarge-shrink {
      height: auto; }
    .grid-y > .xxxlarge-1 {
      height: 8.33333%; }
    .grid-y > .xxxlarge-2 {
      height: 16.66667%; }
    .grid-y > .xxxlarge-3 {
      height: 25%; }
    .grid-y > .xxxlarge-4 {
      height: 33.33333%; }
    .grid-y > .xxxlarge-5 {
      height: 41.66667%; }
    .grid-y > .xxxlarge-6 {
      height: 50%; }
    .grid-y > .xxxlarge-7 {
      height: 58.33333%; }
    .grid-y > .xxxlarge-8 {
      height: 66.66667%; }
    .grid-y > .xxxlarge-9 {
      height: 75%; }
    .grid-y > .xxxlarge-10 {
      height: 83.33333%; }
    .grid-y > .xxxlarge-11 {
      height: 91.66667%; }
    .grid-y > .xxxlarge-12 {
      height: 100%; } }

.grid-padding-y .grid-padding-y {
  margin-top: -0.875rem;
  margin-bottom: -0.875rem; }
  @media print, screen and (min-width: 40em) {
    .grid-padding-y .grid-padding-y {
      margin-top: -0.875rem;
      margin-bottom: -0.875rem; } }

.grid-padding-y > .cell {
  padding-top: 0.875rem;
  padding-bottom: 0.875rem; }
  @media print, screen and (min-width: 40em) {
    .grid-padding-y > .cell {
      padding-top: 0.875rem;
      padding-bottom: 0.875rem; } }

.grid-margin-y {
  margin-top: -0.875rem;
  margin-bottom: -0.875rem; }
  @media print, screen and (min-width: 40em) {
    .grid-margin-y {
      margin-top: -0.875rem;
      margin-bottom: -0.875rem; } }
  .grid-margin-y > .cell {
    height: calc(100% - 1.75rem);
    margin-top: 0.875rem;
    margin-bottom: 0.875rem; }
  @media print, screen and (min-width: 40em) {
    .grid-margin-y > .cell {
      height: calc(100% - 1.75rem);
      margin-top: 0.875rem;
      margin-bottom: 0.875rem; } }
  .grid-margin-y > .auto {
    height: auto; }
  .grid-margin-y > .shrink {
    height: auto; }
  .grid-margin-y > .small-1 {
    height: calc(8.33333% - 1.75rem); }
  .grid-margin-y > .small-2 {
    height: calc(16.66667% - 1.75rem); }
  .grid-margin-y > .small-3 {
    height: calc(25% - 1.75rem); }
  .grid-margin-y > .small-4 {
    height: calc(33.33333% - 1.75rem); }
  .grid-margin-y > .small-5 {
    height: calc(41.66667% - 1.75rem); }
  .grid-margin-y > .small-6 {
    height: calc(50% - 1.75rem); }
  .grid-margin-y > .small-7 {
    height: calc(58.33333% - 1.75rem); }
  .grid-margin-y > .small-8 {
    height: calc(66.66667% - 1.75rem); }
  .grid-margin-y > .small-9 {
    height: calc(75% - 1.75rem); }
  .grid-margin-y > .small-10 {
    height: calc(83.33333% - 1.75rem); }
  .grid-margin-y > .small-11 {
    height: calc(91.66667% - 1.75rem); }
  .grid-margin-y > .small-12 {
    height: calc(100% - 1.75rem); }
  @media print, screen and (min-width: 40em) {
    .grid-margin-y > .auto {
      height: auto; }
    .grid-margin-y > .shrink {
      height: auto; }
    .grid-margin-y > .small-1 {
      height: calc(8.33333% - 1.75rem); }
    .grid-margin-y > .small-2 {
      height: calc(16.66667% - 1.75rem); }
    .grid-margin-y > .small-3 {
      height: calc(25% - 1.75rem); }
    .grid-margin-y > .small-4 {
      height: calc(33.33333% - 1.75rem); }
    .grid-margin-y > .small-5 {
      height: calc(41.66667% - 1.75rem); }
    .grid-margin-y > .small-6 {
      height: calc(50% - 1.75rem); }
    .grid-margin-y > .small-7 {
      height: calc(58.33333% - 1.75rem); }
    .grid-margin-y > .small-8 {
      height: calc(66.66667% - 1.75rem); }
    .grid-margin-y > .small-9 {
      height: calc(75% - 1.75rem); }
    .grid-margin-y > .small-10 {
      height: calc(83.33333% - 1.75rem); }
    .grid-margin-y > .small-11 {
      height: calc(91.66667% - 1.75rem); }
    .grid-margin-y > .small-12 {
      height: calc(100% - 1.75rem); }
    .grid-margin-y > .medium-auto {
      height: auto; }
    .grid-margin-y > .medium-shrink {
      height: auto; }
    .grid-margin-y > .medium-1 {
      height: calc(8.33333% - 1.75rem); }
    .grid-margin-y > .medium-2 {
      height: calc(16.66667% - 1.75rem); }
    .grid-margin-y > .medium-3 {
      height: calc(25% - 1.75rem); }
    .grid-margin-y > .medium-4 {
      height: calc(33.33333% - 1.75rem); }
    .grid-margin-y > .medium-5 {
      height: calc(41.66667% - 1.75rem); }
    .grid-margin-y > .medium-6 {
      height: calc(50% - 1.75rem); }
    .grid-margin-y > .medium-7 {
      height: calc(58.33333% - 1.75rem); }
    .grid-margin-y > .medium-8 {
      height: calc(66.66667% - 1.75rem); }
    .grid-margin-y > .medium-9 {
      height: calc(75% - 1.75rem); }
    .grid-margin-y > .medium-10 {
      height: calc(83.33333% - 1.75rem); }
    .grid-margin-y > .medium-11 {
      height: calc(91.66667% - 1.75rem); }
    .grid-margin-y > .medium-12 {
      height: calc(100% - 1.75rem); } }
  @media print, screen and (min-width: 60em) {
    .grid-margin-y > .large-auto {
      height: auto; }
    .grid-margin-y > .large-shrink {
      height: auto; }
    .grid-margin-y > .large-1 {
      height: calc(8.33333% - 1.75rem); }
    .grid-margin-y > .large-2 {
      height: calc(16.66667% - 1.75rem); }
    .grid-margin-y > .large-3 {
      height: calc(25% - 1.75rem); }
    .grid-margin-y > .large-4 {
      height: calc(33.33333% - 1.75rem); }
    .grid-margin-y > .large-5 {
      height: calc(41.66667% - 1.75rem); }
    .grid-margin-y > .large-6 {
      height: calc(50% - 1.75rem); }
    .grid-margin-y > .large-7 {
      height: calc(58.33333% - 1.75rem); }
    .grid-margin-y > .large-8 {
      height: calc(66.66667% - 1.75rem); }
    .grid-margin-y > .large-9 {
      height: calc(75% - 1.75rem); }
    .grid-margin-y > .large-10 {
      height: calc(83.33333% - 1.75rem); }
    .grid-margin-y > .large-11 {
      height: calc(91.66667% - 1.75rem); }
    .grid-margin-y > .large-12 {
      height: calc(100% - 1.75rem); } }
  @media screen and (min-width: 80em) {
    .grid-margin-y > .xlarge-auto {
      height: auto; }
    .grid-margin-y > .xlarge-shrink {
      height: auto; }
    .grid-margin-y > .xlarge-1 {
      height: calc(8.33333% - 1.75rem); }
    .grid-margin-y > .xlarge-2 {
      height: calc(16.66667% - 1.75rem); }
    .grid-margin-y > .xlarge-3 {
      height: calc(25% - 1.75rem); }
    .grid-margin-y > .xlarge-4 {
      height: calc(33.33333% - 1.75rem); }
    .grid-margin-y > .xlarge-5 {
      height: calc(41.66667% - 1.75rem); }
    .grid-margin-y > .xlarge-6 {
      height: calc(50% - 1.75rem); }
    .grid-margin-y > .xlarge-7 {
      height: calc(58.33333% - 1.75rem); }
    .grid-margin-y > .xlarge-8 {
      height: calc(66.66667% - 1.75rem); }
    .grid-margin-y > .xlarge-9 {
      height: calc(75% - 1.75rem); }
    .grid-margin-y > .xlarge-10 {
      height: calc(83.33333% - 1.75rem); }
    .grid-margin-y > .xlarge-11 {
      height: calc(91.66667% - 1.75rem); }
    .grid-margin-y > .xlarge-12 {
      height: calc(100% - 1.75rem); } }
  @media screen and (min-width: 100em) {
    .grid-margin-y > .xxlarge-auto {
      height: auto; }
    .grid-margin-y > .xxlarge-shrink {
      height: auto; }
    .grid-margin-y > .xxlarge-1 {
      height: calc(8.33333% - 1.75rem); }
    .grid-margin-y > .xxlarge-2 {
      height: calc(16.66667% - 1.75rem); }
    .grid-margin-y > .xxlarge-3 {
      height: calc(25% - 1.75rem); }
    .grid-margin-y > .xxlarge-4 {
      height: calc(33.33333% - 1.75rem); }
    .grid-margin-y > .xxlarge-5 {
      height: calc(41.66667% - 1.75rem); }
    .grid-margin-y > .xxlarge-6 {
      height: calc(50% - 1.75rem); }
    .grid-margin-y > .xxlarge-7 {
      height: calc(58.33333% - 1.75rem); }
    .grid-margin-y > .xxlarge-8 {
      height: calc(66.66667% - 1.75rem); }
    .grid-margin-y > .xxlarge-9 {
      height: calc(75% - 1.75rem); }
    .grid-margin-y > .xxlarge-10 {
      height: calc(83.33333% - 1.75rem); }
    .grid-margin-y > .xxlarge-11 {
      height: calc(91.66667% - 1.75rem); }
    .grid-margin-y > .xxlarge-12 {
      height: calc(100% - 1.75rem); } }
  @media screen and (min-width: 120em) {
    .grid-margin-y > .xxxlarge-auto {
      height: auto; }
    .grid-margin-y > .xxxlarge-shrink {
      height: auto; }
    .grid-margin-y > .xxxlarge-1 {
      height: calc(8.33333% - 1.75rem); }
    .grid-margin-y > .xxxlarge-2 {
      height: calc(16.66667% - 1.75rem); }
    .grid-margin-y > .xxxlarge-3 {
      height: calc(25% - 1.75rem); }
    .grid-margin-y > .xxxlarge-4 {
      height: calc(33.33333% - 1.75rem); }
    .grid-margin-y > .xxxlarge-5 {
      height: calc(41.66667% - 1.75rem); }
    .grid-margin-y > .xxxlarge-6 {
      height: calc(50% - 1.75rem); }
    .grid-margin-y > .xxxlarge-7 {
      height: calc(58.33333% - 1.75rem); }
    .grid-margin-y > .xxxlarge-8 {
      height: calc(66.66667% - 1.75rem); }
    .grid-margin-y > .xxxlarge-9 {
      height: calc(75% - 1.75rem); }
    .grid-margin-y > .xxxlarge-10 {
      height: calc(83.33333% - 1.75rem); }
    .grid-margin-y > .xxxlarge-11 {
      height: calc(91.66667% - 1.75rem); }
    .grid-margin-y > .xxxlarge-12 {
      height: calc(100% - 1.75rem); } }

.grid-frame {
  overflow: hidden;
  position: relative;
  -ms-flex-wrap: nowrap;
      flex-wrap: nowrap;
  -ms-flex-align: stretch;
      align-items: stretch;
  width: 100vw; }

.cell .grid-frame {
  width: 100%; }

.cell-block {
  overflow-x: auto;
  max-width: 100%;
  -webkit-overflow-scrolling: touch;
  -ms-overflow-style: -ms-autohiding-scrollbar; }

.cell-block-y {
  overflow-y: auto;
  max-height: 100%;
  min-height: 100%;
  -webkit-overflow-scrolling: touch;
  -ms-overflow-style: -ms-autohiding-scrollbar; }

.cell-block-container {
  display: -ms-flexbox;
  display: flex;
  -ms-flex-direction: column;
      flex-direction: column;
  max-height: 100%; }
  .cell-block-container > .grid-x {
    max-height: 100%;
    -ms-flex-wrap: nowrap;
        flex-wrap: nowrap; }

@media print, screen and (min-width: 40em) {
  .medium-grid-frame {
    overflow: hidden;
    position: relative;
    -ms-flex-wrap: nowrap;
        flex-wrap: nowrap;
    -ms-flex-align: stretch;
        align-items: stretch;
    width: 100vw; }
  .cell .medium-grid-frame {
    width: 100%; }
  .medium-cell-block {
    overflow-x: auto;
    max-width: 100%;
    -webkit-overflow-scrolling: touch;
    -ms-overflow-style: -ms-autohiding-scrollbar; }
  .medium-cell-block-container {
    display: -ms-flexbox;
    display: flex;
    -ms-flex-direction: column;
        flex-direction: column;
    max-height: 100%; }
    .medium-cell-block-container > .grid-x {
      max-height: 100%;
      -ms-flex-wrap: nowrap;
          flex-wrap: nowrap; }
  .medium-cell-block-y {
    overflow-y: auto;
    max-height: 100%;
    min-height: 100%;
    -webkit-overflow-scrolling: touch;
    -ms-overflow-style: -ms-autohiding-scrollbar; } }

@media print, screen and (min-width: 60em) {
  .large-grid-frame {
    overflow: hidden;
    position: relative;
    -ms-flex-wrap: nowrap;
        flex-wrap: nowrap;
    -ms-flex-align: stretch;
        align-items: stretch;
    width: 100vw; }
  .cell .large-grid-frame {
    width: 100%; }
  .large-cell-block {
    overflow-x: auto;
    max-width: 100%;
    -webkit-overflow-scrolling: touch;
    -ms-overflow-style: -ms-autohiding-scrollbar; }
  .large-cell-block-container {
    display: -ms-flexbox;
    display: flex;
    -ms-flex-direction: column;
        flex-direction: column;
    max-height: 100%; }
    .large-cell-block-container > .grid-x {
      max-height: 100%;
      -ms-flex-wrap: nowrap;
          flex-wrap: nowrap; }
  .large-cell-block-y {
    overflow-y: auto;
    max-height: 100%;
    min-height: 100%;
    -webkit-overflow-scrolling: touch;
    -ms-overflow-style: -ms-autohiding-scrollbar; } }

@media screen and (min-width: 80em) {
  .xlarge-grid-frame {
    overflow: hidden;
    position: relative;
    -ms-flex-wrap: nowrap;
        flex-wrap: nowrap;
    -ms-flex-align: stretch;
        align-items: stretch;
    width: 100vw; }
  .cell .xlarge-grid-frame {
    width: 100%; }
  .xlarge-cell-block {
    overflow-x: auto;
    max-width: 100%;
    -webkit-overflow-scrolling: touch;
    -ms-overflow-style: -ms-autohiding-scrollbar; }
  .xlarge-cell-block-container {
    display: -ms-flexbox;
    display: flex;
    -ms-flex-direction: column;
        flex-direction: column;
    max-height: 100%; }
    .xlarge-cell-block-container > .grid-x {
      max-height: 100%;
      -ms-flex-wrap: nowrap;
          flex-wrap: nowrap; }
  .xlarge-cell-block-y {
    overflow-y: auto;
    max-height: 100%;
    min-height: 100%;
    -webkit-overflow-scrolling: touch;
    -ms-overflow-style: -ms-autohiding-scrollbar; } }

@media screen and (min-width: 100em) {
  .xxlarge-grid-frame {
    overflow: hidden;
    position: relative;
    -ms-flex-wrap: nowrap;
        flex-wrap: nowrap;
    -ms-flex-align: stretch;
        align-items: stretch;
    width: 100vw; }
  .cell .xxlarge-grid-frame {
    width: 100%; }
  .xxlarge-cell-block {
    overflow-x: auto;
    max-width: 100%;
    -webkit-overflow-scrolling: touch;
    -ms-overflow-style: -ms-autohiding-scrollbar; }
  .xxlarge-cell-block-container {
    display: -ms-flexbox;
    display: flex;
    -ms-flex-direction: column;
        flex-direction: column;
    max-height: 100%; }
    .xxlarge-cell-block-container > .grid-x {
      max-height: 100%;
      -ms-flex-wrap: nowrap;
          flex-wrap: nowrap; }
  .xxlarge-cell-block-y {
    overflow-y: auto;
    max-height: 100%;
    min-height: 100%;
    -webkit-overflow-scrolling: touch;
    -ms-overflow-style: -ms-autohiding-scrollbar; } }

@media screen and (min-width: 120em) {
  .xxxlarge-grid-frame {
    overflow: hidden;
    position: relative;
    -ms-flex-wrap: nowrap;
        flex-wrap: nowrap;
    -ms-flex-align: stretch;
        align-items: stretch;
    width: 100vw; }
  .cell .xxxlarge-grid-frame {
    width: 100%; }
  .xxxlarge-cell-block {
    overflow-x: auto;
    max-width: 100%;
    -webkit-overflow-scrolling: touch;
    -ms-overflow-style: -ms-autohiding-scrollbar; }
  .xxxlarge-cell-block-container {
    display: -ms-flexbox;
    display: flex;
    -ms-flex-direction: column;
        flex-direction: column;
    max-height: 100%; }
    .xxxlarge-cell-block-container > .grid-x {
      max-height: 100%;
      -ms-flex-wrap: nowrap;
          flex-wrap: nowrap; }
  .xxxlarge-cell-block-y {
    overflow-y: auto;
    max-height: 100%;
    min-height: 100%;
    -webkit-overflow-scrolling: touch;
    -ms-overflow-style: -ms-autohiding-scrollbar; } }

.grid-y.grid-frame {
  width: auto;
  overflow: hidden;
  position: relative;
  -ms-flex-wrap: nowrap;
      flex-wrap: nowrap;
  -ms-flex-align: stretch;
      align-items: stretch;
  height: 100vh; }

@media print, screen and (min-width: 40em) {
  .grid-y.medium-grid-frame {
    width: auto;
    overflow: hidden;
    position: relative;
    -ms-flex-wrap: nowrap;
        flex-wrap: nowrap;
    -ms-flex-align: stretch;
        align-items: stretch;
    height: 100vh; } }

@media print, screen and (min-width: 60em) {
  .grid-y.large-grid-frame {
    width: auto;
    overflow: hidden;
    position: relative;
    -ms-flex-wrap: nowrap;
        flex-wrap: nowrap;
    -ms-flex-align: stretch;
        align-items: stretch;
    height: 100vh; } }

@media screen and (min-width: 80em) {
  .grid-y.xlarge-grid-frame {
    width: auto;
    overflow: hidden;
    position: relative;
    -ms-flex-wrap: nowrap;
        flex-wrap: nowrap;
    -ms-flex-align: stretch;
        align-items: stretch;
    height: 100vh; } }

@media screen and (min-width: 100em) {
  .grid-y.xxlarge-grid-frame {
    width: auto;
    overflow: hidden;
    position: relative;
    -ms-flex-wrap: nowrap;
        flex-wrap: nowrap;
    -ms-flex-align: stretch;
        align-items: stretch;
    height: 100vh; } }

@media screen and (min-width: 120em) {
  .grid-y.xxxlarge-grid-frame {
    width: auto;
    overflow: hidden;
    position: relative;
    -ms-flex-wrap: nowrap;
        flex-wrap: nowrap;
    -ms-flex-align: stretch;
        align-items: stretch;
    height: 100vh; } }

.cell .grid-y.grid-frame {
  height: 100%; }

@media print, screen and (min-width: 40em) {
  .cell .grid-y.medium-grid-frame {
    height: 100%; } }

@media print, screen and (min-width: 60em) {
  .cell .grid-y.large-grid-frame {
    height: 100%; } }

@media screen and (min-width: 80em) {
  .cell .grid-y.xlarge-grid-frame {
    height: 100%; } }

@media screen and (min-width: 100em) {
  .cell .grid-y.xxlarge-grid-frame {
    height: 100%; } }

@media screen and (min-width: 120em) {
  .cell .grid-y.xxxlarge-grid-frame {
    height: 100%; } }

.grid-margin-y {
  margin-top: -0.875rem;
  margin-bottom: -0.875rem; }
  @media print, screen and (min-width: 40em) {
    .grid-margin-y {
      margin-top: -0.875rem;
      margin-bottom: -0.875rem; } }
  .grid-margin-y > .cell {
    height: calc(100% - 1.75rem);
    margin-top: 0.875rem;
    margin-bottom: 0.875rem; }
  @media print, screen and (min-width: 40em) {
    .grid-margin-y > .cell {
      height: calc(100% - 1.75rem);
      margin-top: 0.875rem;
      margin-bottom: 0.875rem; } }
  .grid-margin-y > .auto {
    height: auto; }
  .grid-margin-y > .shrink {
    height: auto; }
  .grid-margin-y > .small-1 {
    height: calc(8.33333% - 1.75rem); }
  .grid-margin-y > .small-2 {
    height: calc(16.66667% - 1.75rem); }
  .grid-margin-y > .small-3 {
    height: calc(25% - 1.75rem); }
  .grid-margin-y > .small-4 {
    height: calc(33.33333% - 1.75rem); }
  .grid-margin-y > .small-5 {
    height: calc(41.66667% - 1.75rem); }
  .grid-margin-y > .small-6 {
    height: calc(50% - 1.75rem); }
  .grid-margin-y > .small-7 {
    height: calc(58.33333% - 1.75rem); }
  .grid-margin-y > .small-8 {
    height: calc(66.66667% - 1.75rem); }
  .grid-margin-y > .small-9 {
    height: calc(75% - 1.75rem); }
  .grid-margin-y > .small-10 {
    height: calc(83.33333% - 1.75rem); }
  .grid-margin-y > .small-11 {
    height: calc(91.66667% - 1.75rem); }
  .grid-margin-y > .small-12 {
    height: calc(100% - 1.75rem); }
  @media print, screen and (min-width: 40em) {
    .grid-margin-y > .auto {
      height: auto; }
    .grid-margin-y > .shrink {
      height: auto; }
    .grid-margin-y > .small-1 {
      height: calc(8.33333% - 1.75rem); }
    .grid-margin-y > .small-2 {
      height: calc(16.66667% - 1.75rem); }
    .grid-margin-y > .small-3 {
      height: calc(25% - 1.75rem); }
    .grid-margin-y > .small-4 {
      height: calc(33.33333% - 1.75rem); }
    .grid-margin-y > .small-5 {
      height: calc(41.66667% - 1.75rem); }
    .grid-margin-y > .small-6 {
      height: calc(50% - 1.75rem); }
    .grid-margin-y > .small-7 {
      height: calc(58.33333% - 1.75rem); }
    .grid-margin-y > .small-8 {
      height: calc(66.66667% - 1.75rem); }
    .grid-margin-y > .small-9 {
      height: calc(75% - 1.75rem); }
    .grid-margin-y > .small-10 {
      height: calc(83.33333% - 1.75rem); }
    .grid-margin-y > .small-11 {
      height: calc(91.66667% - 1.75rem); }
    .grid-margin-y > .small-12 {
      height: calc(100% - 1.75rem); }
    .grid-margin-y > .medium-auto {
      height: auto; }
    .grid-margin-y > .medium-shrink {
      height: auto; }
    .grid-margin-y > .medium-1 {
      height: calc(8.33333% - 1.75rem); }
    .grid-margin-y > .medium-2 {
      height: calc(16.66667% - 1.75rem); }
    .grid-margin-y > .medium-3 {
      height: calc(25% - 1.75rem); }
    .grid-margin-y > .medium-4 {
      height: calc(33.33333% - 1.75rem); }
    .grid-margin-y > .medium-5 {
      height: calc(41.66667% - 1.75rem); }
    .grid-margin-y > .medium-6 {
      height: calc(50% - 1.75rem); }
    .grid-margin-y > .medium-7 {
      height: calc(58.33333% - 1.75rem); }
    .grid-margin-y > .medium-8 {
      height: calc(66.66667% - 1.75rem); }
    .grid-margin-y > .medium-9 {
      height: calc(75% - 1.75rem); }
    .grid-margin-y > .medium-10 {
      height: calc(83.33333% - 1.75rem); }
    .grid-margin-y > .medium-11 {
      height: calc(91.66667% - 1.75rem); }
    .grid-margin-y > .medium-12 {
      height: calc(100% - 1.75rem); } }
  @media print, screen and (min-width: 60em) {
    .grid-margin-y > .large-auto {
      height: auto; }
    .grid-margin-y > .large-shrink {
      height: auto; }
    .grid-margin-y > .large-1 {
      height: calc(8.33333% - 1.75rem); }
    .grid-margin-y > .large-2 {
      height: calc(16.66667% - 1.75rem); }
    .grid-margin-y > .large-3 {
      height: calc(25% - 1.75rem); }
    .grid-margin-y > .large-4 {
      height: calc(33.33333% - 1.75rem); }
    .grid-margin-y > .large-5 {
      height: calc(41.66667% - 1.75rem); }
    .grid-margin-y > .large-6 {
      height: calc(50% - 1.75rem); }
    .grid-margin-y > .large-7 {
      height: calc(58.33333% - 1.75rem); }
    .grid-margin-y > .large-8 {
      height: calc(66.66667% - 1.75rem); }
    .grid-margin-y > .large-9 {
      height: calc(75% - 1.75rem); }
    .grid-margin-y > .large-10 {
      height: calc(83.33333% - 1.75rem); }
    .grid-margin-y > .large-11 {
      height: calc(91.66667% - 1.75rem); }
    .grid-margin-y > .large-12 {
      height: calc(100% - 1.75rem); } }
  @media screen and (min-width: 80em) {
    .grid-margin-y > .xlarge-auto {
      height: auto; }
    .grid-margin-y > .xlarge-shrink {
      height: auto; }
    .grid-margin-y > .xlarge-1 {
      height: calc(8.33333% - 1.75rem); }
    .grid-margin-y > .xlarge-2 {
      height: calc(16.66667% - 1.75rem); }
    .grid-margin-y > .xlarge-3 {
      height: calc(25% - 1.75rem); }
    .grid-margin-y > .xlarge-4 {
      height: calc(33.33333% - 1.75rem); }
    .grid-margin-y > .xlarge-5 {
      height: calc(41.66667% - 1.75rem); }
    .grid-margin-y > .xlarge-6 {
      height: calc(50% - 1.75rem); }
    .grid-margin-y > .xlarge-7 {
      height: calc(58.33333% - 1.75rem); }
    .grid-margin-y > .xlarge-8 {
      height: calc(66.66667% - 1.75rem); }
    .grid-margin-y > .xlarge-9 {
      height: calc(75% - 1.75rem); }
    .grid-margin-y > .xlarge-10 {
      height: calc(83.33333% - 1.75rem); }
    .grid-margin-y > .xlarge-11 {
      height: calc(91.66667% - 1.75rem); }
    .grid-margin-y > .xlarge-12 {
      height: calc(100% - 1.75rem); } }
  @media screen and (min-width: 100em) {
    .grid-margin-y > .xxlarge-auto {
      height: auto; }
    .grid-margin-y > .xxlarge-shrink {
      height: auto; }
    .grid-margin-y > .xxlarge-1 {
      height: calc(8.33333% - 1.75rem); }
    .grid-margin-y > .xxlarge-2 {
      height: calc(16.66667% - 1.75rem); }
    .grid-margin-y > .xxlarge-3 {
      height: calc(25% - 1.75rem); }
    .grid-margin-y > .xxlarge-4 {
      height: calc(33.33333% - 1.75rem); }
    .grid-margin-y > .xxlarge-5 {
      height: calc(41.66667% - 1.75rem); }
    .grid-margin-y > .xxlarge-6 {
      height: calc(50% - 1.75rem); }
    .grid-margin-y > .xxlarge-7 {
      height: calc(58.33333% - 1.75rem); }
    .grid-margin-y > .xxlarge-8 {
      height: calc(66.66667% - 1.75rem); }
    .grid-margin-y > .xxlarge-9 {
      height: calc(75% - 1.75rem); }
    .grid-margin-y > .xxlarge-10 {
      height: calc(83.33333% - 1.75rem); }
    .grid-margin-y > .xxlarge-11 {
      height: calc(91.66667% - 1.75rem); }
    .grid-margin-y > .xxlarge-12 {
      height: calc(100% - 1.75rem); } }
  @media screen and (min-width: 120em) {
    .grid-margin-y > .xxxlarge-auto {
      height: auto; }
    .grid-margin-y > .xxxlarge-shrink {
      height: auto; }
    .grid-margin-y > .xxxlarge-1 {
      height: calc(8.33333% - 1.75rem); }
    .grid-margin-y > .xxxlarge-2 {
      height: calc(16.66667% - 1.75rem); }
    .grid-margin-y > .xxxlarge-3 {
      height: calc(25% - 1.75rem); }
    .grid-margin-y > .xxxlarge-4 {
      height: calc(33.33333% - 1.75rem); }
    .grid-margin-y > .xxxlarge-5 {
      height: calc(41.66667% - 1.75rem); }
    .grid-margin-y > .xxxlarge-6 {
      height: calc(50% - 1.75rem); }
    .grid-margin-y > .xxxlarge-7 {
      height: calc(58.33333% - 1.75rem); }
    .grid-margin-y > .xxxlarge-8 {
      height: calc(66.66667% - 1.75rem); }
    .grid-margin-y > .xxxlarge-9 {
      height: calc(75% - 1.75rem); }
    .grid-margin-y > .xxxlarge-10 {
      height: calc(83.33333% - 1.75rem); }
    .grid-margin-y > .xxxlarge-11 {
      height: calc(91.66667% - 1.75rem); }
    .grid-margin-y > .xxxlarge-12 {
      height: calc(100% - 1.75rem); } }

.grid-frame.grid-margin-y {
  height: calc(100vh + 1.75rem); }
  @media print, screen and (min-width: 40em) {
    .grid-frame.grid-margin-y {
      height: calc(100vh + 1.75rem); } }
  @media print, screen and (min-width: 60em) {
    .grid-frame.grid-margin-y {
      height: calc(100vh + 1.75rem); } }
  @media screen and (min-width: 80em) {
    .grid-frame.grid-margin-y {
      height: calc(100vh + 1.75rem); } }
  @media screen and (min-width: 100em) {
    .grid-frame.grid-margin-y {
      height: calc(100vh + 1.75rem); } }
  @media screen and (min-width: 120em) {
    .grid-frame.grid-margin-y {
      height: calc(100vh + 1.75rem); } }

@media print, screen and (min-width: 40em) {
  .grid-margin-y.medium-grid-frame {
    height: calc(100vh + 1.75rem); } }

@media print, screen and (min-width: 60em) {
  .grid-margin-y.large-grid-frame {
    height: calc(100vh + 1.75rem); } }

@media screen and (min-width: 80em) {
  .grid-margin-y.xlarge-grid-frame {
    height: calc(100vh + 1.75rem); } }

@media screen and (min-width: 100em) {
  .grid-margin-y.xxlarge-grid-frame {
    height: calc(100vh + 1.75rem); } }

@media screen and (min-width: 120em) {
  .grid-margin-y.xxxlarge-grid-frame {
    height: calc(100vh + 1.75rem); } }

div,
dl,
dt,
dd,
ul,
ol,
li,
h1,
h2,
h3,
h4,
h5,
h6,
pre,
form,
p,
blockquote,
th,
td {
  margin: 0;
  padding: 0; }

p {
  margin-bottom: 0;
  font-size: inherit;
  line-height: 1.33;
  text-rendering: optimizeLegibility; }

em,
i {
  font-style: italic;
  line-height: inherit; }

strong,
b {
  font-weight: bold;
  line-height: inherit; }

small {
  font-size: 0.875rem;
  line-height: inherit; }

h1, .h1,
h2, .h2,
h3, .h3,
h4, .h4,
h5, .h5,
h6, .h6 {
  font-family: Lato, Helvetica, Arial, sans-serif;
  font-style: normal;
  font-weight: normal;
  color: inherit;
  text-rendering: optimizeLegibility; }
  h1 small, .h1 small,
  h2 small, .h2 small,
  h3 small, .h3 small,
  h4 small, .h4 small,
  h5 small, .h5 small,
  h6 small, .h6 small {
    line-height: 0;
    color: #aaa; }

h1, .h1 {
  font-size: 2rem;
  line-height: 1.33;
  margin-top: 0;
  margin-bottom: 0; }

h2, .h2 {
  font-size: 1.625rem;
  line-height: 1.33;
  margin-top: 0;
  margin-bottom: 0; }

h3, .h3 {
  font-size: 1.25rem;
  line-height: 1.33;
  margin-top: 0;
  margin-bottom: 0; }

h4, .h4 {
  font-size: 1.125rem;
  line-height: 1.33;
  margin-top: 0;
  margin-bottom: 0; }

h5, .h5 {
  font-size: 1rem;
  line-height: 1.33;
  margin-top: 0;
  margin-bottom: 0; }

h6, .h6 {
  font-size: 1rem;
  line-height: 1.33;
  margin-top: 0;
  margin-bottom: 0; }

@media print, screen and (min-width: 40em) {
  h1, .h1 {
    font-size: 2.25rem; }
  h2, .h2 {
    font-size: 1.75rem; }
  h3, .h3 {
    font-size: 1.3125rem; }
  h4, .h4 {
    font-size: 1.25rem; }
  h5, .h5 {
    font-size: 1.125rem; }
  h6, .h6 {
    font-size: 1rem; } }

a {
  line-height: inherit;
  color: inherit;
  text-decoration: underline;
  cursor: pointer; }
  a:hover, a:focus {
    color: rgba(51, 51, 51, 0.75); }
  a.button {
    text-decoration: none; }
  a img {
    border: 0; }

hr {
  clear: both;
  max-width: none;
  height: 0;
  margin: 0.5rem auto;
  border-top: 0;
  border-right: 0;
  border-bottom: 1px solid #e3e3e3;
  border-left: 0; }

ul,
ol,
dl {
  margin-bottom: 0;
  list-style-position: outside;
  line-height: 1.33; }

li {
  font-size: inherit; }

ul {
  margin-left: 1.5rem;
  list-style-type: disc; }

ol {
  margin-left: 1.5rem; }

ul ul, ol ul, ul ol, ol ol {
  margin-left: 1.5rem;
  margin-bottom: 0; }

dl {
  margin-bottom: 1rem; }
  dl dt {
    margin-bottom: 0.3rem;
    font-weight: bold; }

blockquote {
  margin: 0 0 0;
  padding: 0.5625rem 1.25rem 0 1.1875rem;
  border-left: 1px solid #aaa; }
  blockquote, blockquote p {
    line-height: 1.33;
    color: #757575; }

abbr, abbr[title] {
  border-bottom: 1px dotted #333;
  cursor: help;
  text-decoration: none; }

figure {
  margin: 0; }

kbd {
  margin: 0;
  padding: 0.125rem 0.25rem 0;
  background-color: #e3e3e3;
  font-family: Courier, monospace;
  color: #333;
  border-radius: 2px; }

.subheader {
  margin-top: 0.2rem;
  margin-bottom: 0.5rem;
  font-weight: normal;
  line-height: 1.4;
  color: #757575; }

.lead {
  font-size: 1.25rem;
  line-height: 1.6; }

.stat {
  font-size: 2.5rem;
  line-height: 1; }
  p + .stat {
    margin-top: -1rem; }

ul.no-bullet, ol.no-bullet {
  margin-left: 0;
  list-style: none; }

.cite-block, cite {
  display: block;
  color: #757575;
  font-size: 0.875rem; }
  .cite-block:before, cite:before {
    content: "— "; }

.code-inline, code {
  border: 1px solid #aaa;
  background-color: #e3e3e3;
  font-family: Courier, monospace;
  font-weight: normal;
  color: #333;
  display: inline;
  max-width: 100%;
  word-wrap: break-word;
  padding: 0.125rem 0.3125rem 0.0625rem; }

.code-block {
  border: 1px solid #aaa;
  background-color: #e3e3e3;
  font-family: Courier, monospace;
  font-weight: normal;
  color: #333;
  display: block;
  overflow: auto;
  white-space: pre;
  padding: 1rem;
  margin-bottom: 1.5rem; }

.text-left {
  text-align: left; }

.text-right {
  text-align: right; }

.text-center {
  text-align: center; }

.text-justify {
  text-align: justify; }

@media print, screen and (min-width: 40em) {
  .medium-text-left {
    text-align: left; }
  .medium-text-right {
    text-align: right; }
  .medium-text-center {
    text-align: center; }
  .medium-text-justify {
    text-align: justify; } }

@media print, screen and (min-width: 60em) {
  .large-text-left {
    text-align: left; }
  .large-text-right {
    text-align: right; }
  .large-text-center {
    text-align: center; }
  .large-text-justify {
    text-align: justify; } }

@media screen and (min-width: 80em) {
  .xlarge-text-left {
    text-align: left; }
  .xlarge-text-right {
    text-align: right; }
  .xlarge-text-center {
    text-align: center; }
  .xlarge-text-justify {
    text-align: justify; } }

@media screen and (min-width: 100em) {
  .xxlarge-text-left {
    text-align: left; }
  .xxlarge-text-right {
    text-align: right; }
  .xxlarge-text-center {
    text-align: center; }
  .xxlarge-text-justify {
    text-align: justify; } }

@media screen and (min-width: 120em) {
  .xxxlarge-text-left {
    text-align: left; }
  .xxxlarge-text-right {
    text-align: right; }
  .xxxlarge-text-center {
    text-align: center; }
  .xxxlarge-text-justify {
    text-align: justify; } }

.show-for-print {
  display: none !important; }

@media print {
  * {
    background: transparent !important;
    color: black !important;
    color-adjust: economy;
    box-shadow: none !important;
    text-shadow: none !important; }
  .show-for-print {
    display: block !important; }
  .hide-for-print {
    display: none !important; }
  table.show-for-print {
    display: table !important; }
  thead.show-for-print {
    display: table-header-group !important; }
  tbody.show-for-print {
    display: table-row-group !important; }
  tr.show-for-print {
    display: table-row !important; }
  td.show-for-print {
    display: table-cell !important; }
  th.show-for-print {
    display: table-cell !important; }
  a,
  a:visited {
    text-decoration: underline; }
  a[href]:after {
    content: " (" attr(href) ")"; }
  .ir a:after,
  a[href^='javascript:']:after,
  a[href^='#']:after {
    content: ''; }
  abbr[title]:after {
    content: " (" attr(title) ")"; }
  pre,
  blockquote {
    border: 1px solid #757575;
    page-break-inside: avoid; }
  thead {
    display: table-header-group; }
  tr,
  img {
    page-break-inside: avoid; }
  img {
    max-width: 100% !important; }
  @page {
    margin: 0.5cm; }
  p,
  h2,
  h3 {
    orphans: 3;
    widows: 3; }
  h2,
  h3 {
    page-break-after: avoid; }
  .print-break-inside {
    page-break-inside: auto; } }

.button {
  display: inline-block;
  vertical-align: middle;
  margin: 0 0 0 0;
  padding: 0.875rem 1rem 0.825rem;
  border: 1px solid transparent;
  border-radius: 2px;
  transition: background-color 0.25s ease-out, color 0.25s ease-out;
  font-family: inherit;
  font-size: 0.875rem;
  font-weight: bold;
  -webkit-appearance: none;
  line-height: 1;
  text-align: center;
  cursor: pointer; }
  [data-whatinput='mouse'] .button {
    outline: 0; }
  .button.tiny {
    font-size: 0.6rem; }
  .button.small {
    font-size: 0.75rem; }
  .button.large {
    font-size: 1.25rem; }
  .button.expanded {
    display: block;
    width: 100%;
    margin-right: 0;
    margin-left: 0; }
  @media print, screen and (max-width: 39.99875em) {
    .button.small-only-expanded {
      display: block;
      width: 100%;
      margin-right: 0;
      margin-left: 0; } }
  @media print, screen and (min-width: 40em) and (max-width: 59.99875em) {
    .button.medium-only-expanded {
      display: block;
      width: 100%;
      margin-right: 0;
      margin-left: 0; } }
  @media print, screen and (max-width: 59.99875em) {
    .button.medium-down-expanded {
      display: block;
      width: 100%;
      margin-right: 0;
      margin-left: 0; } }
  @media print, screen and (min-width: 40em) {
    .button.medium-expanded {
      display: block;
      width: 100%;
      margin-right: 0;
      margin-left: 0; } }
  @media print, screen and (min-width: 60em) and (max-width: 79.99875em) {
    .button.large-only-expanded {
      display: block;
      width: 100%;
      margin-right: 0;
      margin-left: 0; } }
  @media print, screen and (max-width: 79.99875em) {
    .button.large-down-expanded {
      display: block;
      width: 100%;
      margin-right: 0;
      margin-left: 0; } }
  @media print, screen and (min-width: 60em) {
    .button.large-expanded {
      display: block;
      width: 100%;
      margin-right: 0;
      margin-left: 0; } }
  @media screen and (min-width: 80em) and (max-width: 99.99875em) {
    .button.xlarge-only-expanded {
      display: block;
      width: 100%;
      margin-right: 0;
      margin-left: 0; } }
  @media print, screen and (max-width: 99.99875em) {
    .button.xlarge-down-expanded {
      display: block;
      width: 100%;
      margin-right: 0;
      margin-left: 0; } }
  @media screen and (min-width: 80em) {
    .button.xlarge-expanded {
      display: block;
      width: 100%;
      margin-right: 0;
      margin-left: 0; } }
  @media screen and (min-width: 100em) and (max-width: 119.99875em) {
    .button.xxlarge-only-expanded {
      display: block;
      width: 100%;
      margin-right: 0;
      margin-left: 0; } }
  @media print, screen and (max-width: 119.99875em) {
    .button.xxlarge-down-expanded {
      display: block;
      width: 100%;
      margin-right: 0;
      margin-left: 0; } }
  @media screen and (min-width: 100em) {
    .button.xxlarge-expanded {
      display: block;
      width: 100%;
      margin-right: 0;
      margin-left: 0; } }
  @media screen and (min-width: 120em) {
    .button.xxxlarge-only-expanded {
      display: block;
      width: 100%;
      margin-right: 0;
      margin-left: 0; } }
  .button.xxxlarge-down-expanded {
    display: block;
    width: 100%;
    margin-right: 0;
    margin-left: 0; }
  @media screen and (min-width: 120em) {
    .button.xxxlarge-expanded {
      display: block;
      width: 100%;
      margin-right: 0;
      margin-left: 0; } }
  .button, .button.disabled, .button[disabled], .button.disabled:hover, .button[disabled]:hover, .button.disabled:focus, .button[disabled]:focus {
    background-color: #e75635;
    color: #fefefe; }
  .button:hover, .button:focus {
    background-color: #d83d1a;
    color: #fefefe; }
  .button.primary, .button.primary.disabled, .button.primary[disabled], .button.primary.disabled:hover, .button.primary[disabled]:hover, .button.primary.disabled:focus, .button.primary[disabled]:focus {
    background-color: #e75635;
    color: #fefefe; }
  .button.primary:hover, .button.primary:focus {
    background-color: #cb3918;
    color: #fefefe; }
  .button.secondary, .button.secondary.disabled, .button.secondary[disabled], .button.secondary.disabled:hover, .button.secondary[disabled]:hover, .button.secondary.disabled:focus, .button.secondary[disabled]:focus {
    background-color: #50aaeb;
    color: #333; }
  .button.secondary:hover, .button.secondary:focus {
    background-color: #1a8ee2;
    color: #333; }
  .button.success, .button.success.disabled, .button.success[disabled], .button.success.disabled:hover, .button.success[disabled]:hover, .button.success.disabled:focus, .button.success[disabled]:focus {
    background-color: #66c17b;
    color: #333; }
  .button.success:hover, .button.success:focus {
    background-color: #44a85b;
    color: #333; }
  .button.warning, .button.warning.disabled, .button.warning[disabled], .button.warning.disabled:hover, .button.warning[disabled]:hover, .button.warning.disabled:focus, .button.warning[disabled]:focus {
    background-color: #ffae00;
    color: #333; }
  .button.warning:hover, .button.warning:focus {
    background-color: #cc8b00;
    color: #333; }
  .button.alert, .button.alert.disabled, .button.alert[disabled], .button.alert.disabled:hover, .button.alert[disabled]:hover, .button.alert.disabled:focus, .button.alert[disabled]:focus {
    background-color: #cc4b37;
    color: #fefefe; }
  .button.alert:hover, .button.alert:focus {
    background-color: #a53b2a;
    color: #fefefe; }
  .button.black, .button.black.disabled, .button.black[disabled], .button.black.disabled:hover, .button.black[disabled]:hover, .button.black.disabled:focus, .button.black[disabled]:focus {
    background-color: #333;
    color: #fefefe; }
  .button.black:hover, .button.black:focus {
    background-color: #292929;
    color: #fefefe; }
  .button.dark-gray, .button.dark-gray.disabled, .button.dark-gray[disabled], .button.dark-gray.disabled:hover, .button.dark-gray[disabled]:hover, .button.dark-gray.disabled:focus, .button.dark-gray[disabled]:focus {
    background-color: #757575;
    color: #fefefe; }
  .button.dark-gray:hover, .button.dark-gray:focus {
    background-color: #5e5e5e;
    color: #fefefe; }
  .button.medium-gray, .button.medium-gray.disabled, .button.medium-gray[disabled], .button.medium-gray.disabled:hover, .button.medium-gray[disabled]:hover, .button.medium-gray.disabled:focus, .button.medium-gray[disabled]:focus {
    background-color: #aaa;
    color: #333; }
  .button.medium-gray:hover, .button.medium-gray:focus {
    background-color: #888888;
    color: #333; }
  .button.purple, .button.purple.disabled, .button.purple[disabled], .button.purple.disabled:hover, .button.purple[disabled]:hover, .button.purple.disabled:focus, .button.purple[disabled]:focus {
    background-color: #b87af5;
    color: #333; }
  .button.purple:hover, .button.purple:focus {
    background-color: #9436f0;
    color: #333; }
  .button.white, .button.white.disabled, .button.white[disabled], .button.white.disabled:hover, .button.white[disabled]:hover, .button.white.disabled:focus, .button.white[disabled]:focus {
    background-color: #fefefe;
    color: #333; }
  .button.white:hover, .button.white:focus {
    background-color: #cbcbcb;
    color: #333; }
  .button.hollow, .button.hollow:hover, .button.hollow:focus, .button.hollow.disabled, .button.hollow.disabled:hover, .button.hollow.disabled:focus, .button.hollow[disabled], .button.hollow[disabled]:hover, .button.hollow[disabled]:focus {
    background-color: transparent; }
  .button.hollow, .button.hollow.disabled, .button.hollow[disabled], .button.hollow.disabled:hover, .button.hollow[disabled]:hover, .button.hollow.disabled:focus, .button.hollow[disabled]:focus {
    border: 1px solid #e75635;
    color: #e75635; }
  .button.hollow:hover, .button.hollow:focus {
    border-color: #7f240f;
    color: #7f240f; }
  .button.hollow.primary, .button.hollow.primary.disabled, .button.hollow.primary[disabled], .button.hollow.primary.disabled:hover, .button.hollow.primary[disabled]:hover, .button.hollow.primary.disabled:focus, .button.hollow.primary[disabled]:focus {
    border: 1px solid #e75635;
    color: #e75635; }
  .button.hollow.primary:hover, .button.hollow.primary:focus {
    border-color: #7f240f;
    color: #7f240f; }
  .button.hollow.secondary, .button.hollow.secondary.disabled, .button.hollow.secondary[disabled], .button.hollow.secondary.disabled:hover, .button.hollow.secondary[disabled]:hover, .button.hollow.secondary.disabled:focus, .button.hollow.secondary[disabled]:focus {
    border: 1px solid #50aaeb;
    color: #50aaeb; }
  .button.hollow.secondary:hover, .button.hollow.secondary:focus {
    border-color: #10598d;
    color: #10598d; }
  .button.hollow.success, .button.hollow.success.disabled, .button.hollow.success[disabled], .button.hollow.success.disabled:hover, .button.hollow.success[disabled]:hover, .button.hollow.success.disabled:focus, .button.hollow.success[disabled]:focus {
    border: 1px solid #66c17b;
    color: #66c17b; }
  .button.hollow.success:hover, .button.hollow.success:focus {
    border-color: #2b6939;
    color: #2b6939; }
  .button.hollow.warning, .button.hollow.warning.disabled, .button.hollow.warning[disabled], .button.hollow.warning.disabled:hover, .button.hollow.warning[disabled]:hover, .button.hollow.warning.disabled:focus, .button.hollow.warning[disabled]:focus {
    border: 1px solid #ffae00;
    color: #ffae00; }
  .button.hollow.warning:hover, .button.hollow.warning:focus {
    border-color: #805700;
    color: #805700; }
  .button.hollow.alert, .button.hollow.alert.disabled, .button.hollow.alert[disabled], .button.hollow.alert.disabled:hover, .button.hollow.alert[disabled]:hover, .button.hollow.alert.disabled:focus, .button.hollow.alert[disabled]:focus {
    border: 1px solid #cc4b37;
    color: #cc4b37; }
  .button.hollow.alert:hover, .button.hollow.alert:focus {
    border-color: #67251a;
    color: #67251a; }
  .button.hollow.black, .button.hollow.black.disabled, .button.hollow.black[disabled], .button.hollow.black.disabled:hover, .button.hollow.black[disabled]:hover, .button.hollow.black.disabled:focus, .button.hollow.black[disabled]:focus {
    border: 1px solid #333;
    color: #333; }
  .button.hollow.black:hover, .button.hollow.black:focus {
    border-color: #1a1a1a;
    color: #1a1a1a; }
  .button.hollow.dark-gray, .button.hollow.dark-gray.disabled, .button.hollow.dark-gray[disabled], .button.hollow.dark-gray.disabled:hover, .button.hollow.dark-gray[disabled]:hover, .button.hollow.dark-gray.disabled:focus, .button.hollow.dark-gray[disabled]:focus {
    border: 1px solid #757575;
    color: #757575; }
  .button.hollow.dark-gray:hover, .button.hollow.dark-gray:focus {
    border-color: #3b3b3b;
    color: #3b3b3b; }
  .button.hollow.medium-gray, .button.hollow.medium-gray.disabled, .button.hollow.medium-gray[disabled], .button.hollow.medium-gray.disabled:hover, .button.hollow.medium-gray[disabled]:hover, .button.hollow.medium-gray.disabled:focus, .button.hollow.medium-gray[disabled]:focus {
    border: 1px solid #aaa;
    color: #aaa; }
  .button.hollow.medium-gray:hover, .button.hollow.medium-gray:focus {
    border-color: #555555;
    color: #555555; }
  .button.hollow.purple, .button.hollow.purple.disabled, .button.hollow.purple[disabled], .button.hollow.purple.disabled:hover, .button.hollow.purple[disabled]:hover, .button.hollow.purple.disabled:focus, .button.hollow.purple[disabled]:focus {
    border: 1px solid #b87af5;
    color: #b87af5; }
  .button.hollow.purple:hover, .button.hollow.purple:focus {
    border-color: #5c0dab;
    color: #5c0dab; }
  .button.hollow.white, .button.hollow.white.disabled, .button.hollow.white[disabled], .button.hollow.white.disabled:hover, .button.hollow.white[disabled]:hover, .button.hollow.white.disabled:focus, .button.hollow.white[disabled]:focus {
    border: 1px solid #fefefe;
    color: #fefefe; }
  .button.hollow.white:hover, .button.hollow.white:focus {
    border-color: #7f7f7f;
    color: #7f7f7f; }
  .button.clear, .button.clear:hover, .button.clear:focus, .button.clear.disabled, .button.clear.disabled:hover, .button.clear.disabled:focus, .button.clear[disabled], .button.clear[disabled]:hover, .button.clear[disabled]:focus {
    border-color: transparent;
    background-color: transparent; }
  .button.clear, .button.clear.disabled, .button.clear[disabled], .button.clear.disabled:hover, .button.clear[disabled]:hover, .button.clear.disabled:focus, .button.clear[disabled]:focus {
    color: #e75635; }
  .button.clear:hover, .button.clear:focus {
    color: #7f240f; }
  .button.clear.primary, .button.clear.primary.disabled, .button.clear.primary[disabled], .button.clear.primary.disabled:hover, .button.clear.primary[disabled]:hover, .button.clear.primary.disabled:focus, .button.clear.primary[disabled]:focus {
    color: #e75635; }
  .button.clear.primary:hover, .button.clear.primary:focus {
    color: #7f240f; }
  .button.clear.secondary, .button.clear.secondary.disabled, .button.clear.secondary[disabled], .button.clear.secondary.disabled:hover, .button.clear.secondary[disabled]:hover, .button.clear.secondary.disabled:focus, .button.clear.secondary[disabled]:focus {
    color: #50aaeb; }
  .button.clear.secondary:hover, .button.clear.secondary:focus {
    color: #10598d; }
  .button.clear.success, .button.clear.success.disabled, .button.clear.success[disabled], .button.clear.success.disabled:hover, .button.clear.success[disabled]:hover, .button.clear.success.disabled:focus, .button.clear.success[disabled]:focus {
    color: #66c17b; }
  .button.clear.success:hover, .button.clear.success:focus {
    color: #2b6939; }
  .button.clear.warning, .button.clear.warning.disabled, .button.clear.warning[disabled], .button.clear.warning.disabled:hover, .button.clear.warning[disabled]:hover, .button.clear.warning.disabled:focus, .button.clear.warning[disabled]:focus {
    color: #ffae00; }
  .button.clear.warning:hover, .button.clear.warning:focus {
    color: #805700; }
  .button.clear.alert, .button.clear.alert.disabled, .button.clear.alert[disabled], .button.clear.alert.disabled:hover, .button.clear.alert[disabled]:hover, .button.clear.alert.disabled:focus, .button.clear.alert[disabled]:focus {
    color: #cc4b37; }
  .button.clear.alert:hover, .button.clear.alert:focus {
    color: #67251a; }
  .button.clear.black, .button.clear.black.disabled, .button.clear.black[disabled], .button.clear.black.disabled:hover, .button.clear.black[disabled]:hover, .button.clear.black.disabled:focus, .button.clear.black[disabled]:focus {
    color: #333; }
  .button.clear.black:hover, .button.clear.black:focus {
    color: #1a1a1a; }
  .button.clear.dark-gray, .button.clear.dark-gray.disabled, .button.clear.dark-gray[disabled], .button.clear.dark-gray.disabled:hover, .button.clear.dark-gray[disabled]:hover, .button.clear.dark-gray.disabled:focus, .button.clear.dark-gray[disabled]:focus {
    color: #757575; }
  .button.clear.dark-gray:hover, .button.clear.dark-gray:focus {
    color: #3b3b3b; }
  .button.clear.medium-gray, .button.clear.medium-gray.disabled, .button.clear.medium-gray[disabled], .button.clear.medium-gray.disabled:hover, .button.clear.medium-gray[disabled]:hover, .button.clear.medium-gray.disabled:focus, .button.clear.medium-gray[disabled]:focus {
    color: #aaa; }
  .button.clear.medium-gray:hover, .button.clear.medium-gray:focus {
    color: #555555; }
  .button.clear.purple, .button.clear.purple.disabled, .button.clear.purple[disabled], .button.clear.purple.disabled:hover, .button.clear.purple[disabled]:hover, .button.clear.purple.disabled:focus, .button.clear.purple[disabled]:focus {
    color: #b87af5; }
  .button.clear.purple:hover, .button.clear.purple:focus {
    color: #5c0dab; }
  .button.clear.white, .button.clear.white.disabled, .button.clear.white[disabled], .button.clear.white.disabled:hover, .button.clear.white[disabled]:hover, .button.clear.white.disabled:focus, .button.clear.white[disabled]:focus {
    color: #fefefe; }
  .button.clear.white:hover, .button.clear.white:focus {
    color: #7f7f7f; }
  .button.disabled, .button[disabled] {
    opacity: 0.25;
    cursor: not-allowed; }
  .button.dropdown::after {
    display: block;
    width: 0;
    height: 0;
    border: inset 0.4em;
    content: '';
    border-bottom-width: 0;
    border-top-style: solid;
    border-color: #fefefe transparent transparent;
    position: relative;
    top: 0.4em;
    display: inline-block;
    float: right;
    margin-left: 1rem; }
  .button.dropdown.hollow::after, .button.dropdown.clear::after {
    border-top-color: #e75635; }
  .button.dropdown.hollow.primary::after, .button.dropdown.clear.primary::after {
    border-top-color: #e75635; }
  .button.dropdown.hollow.secondary::after, .button.dropdown.clear.secondary::after {
    border-top-color: #50aaeb; }
  .button.dropdown.hollow.success::after, .button.dropdown.clear.success::after {
    border-top-color: #66c17b; }
  .button.dropdown.hollow.warning::after, .button.dropdown.clear.warning::after {
    border-top-color: #ffae00; }
  .button.dropdown.hollow.alert::after, .button.dropdown.clear.alert::after {
    border-top-color: #cc4b37; }
  .button.dropdown.hollow.black::after, .button.dropdown.clear.black::after {
    border-top-color: #333; }
  .button.dropdown.hollow.dark-gray::after, .button.dropdown.clear.dark-gray::after {
    border-top-color: #757575; }
  .button.dropdown.hollow.medium-gray::after, .button.dropdown.clear.medium-gray::after {
    border-top-color: #aaa; }
  .button.dropdown.hollow.purple::after, .button.dropdown.clear.purple::after {
    border-top-color: #b87af5; }
  .button.dropdown.hollow.white::after, .button.dropdown.clear.white::after {
    border-top-color: #fefefe; }
  .button.arrow-only::after {
    top: -0.1em;
    float: none;
    margin-left: 0; }

a.button:hover, a.button:focus {
  text-decoration: none; }

[type='text'], [type='password'], [type='date'], [type='datetime'], [type='datetime-local'], [type='month'], [type='week'], [type='email'], [type='number'], [type='search'], [type='tel'], [type='time'], [type='url'], [type='color'],
textarea {
  display: block;
  box-sizing: border-box;
  width: 100%;
  height: 2.9875rem;
  margin: 0 0 0;
  padding: 0.825rem;
  border: 1px solid transparent;
  border-radius: 2px;
  background-color: #fefefe;
  box-shadow: none;
  font-family: inherit;
  font-size: 1rem;
  font-weight: normal;
  line-height: 1.4;
  color: #333;
  transition: box-shadow 0.5s, border-color 0.25s ease-in-out;
  -webkit-appearance: none;
     -moz-appearance: none;
          appearance: none; }
  [type='text']:focus, [type='password']:focus, [type='date']:focus, [type='datetime']:focus, [type='datetime-local']:focus, [type='month']:focus, [type='week']:focus, [type='email']:focus, [type='number']:focus, [type='search']:focus, [type='tel']:focus, [type='time']:focus, [type='url']:focus, [type='color']:focus,
  textarea:focus {
    outline: none;
    border: 1px solid transparent;
    background-color: #fefefe;
    box-shadow: none;
    transition: box-shadow 0.5s, border-color 0.25s ease-in-out; }

textarea {
  max-width: 100%; }
  textarea[rows] {
    height: auto; }

input:disabled, input[readonly],
textarea:disabled,
textarea[readonly] {
  background-color: transparent;
  cursor: not-allowed; }

[type='submit'],
[type='button'] {
  -webkit-appearance: none;
     -moz-appearance: none;
          appearance: none;
  border-radius: 2px; }

input[type='search'] {
  box-sizing: border-box; }

:-ms-input-placeholder {
  color: #aaa; }

::placeholder {
  color: #aaa; }

[type='file'],
[type='checkbox'],
[type='radio'] {
  margin: 0 0 0; }

[type='checkbox'] + label,
[type='radio'] + label {
  display: inline-block;
  vertical-align: baseline;
  margin-left: 0;
  margin-right: 0;
  margin-bottom: 0; }
  [type='checkbox'] + label[for],
  [type='radio'] + label[for] {
    cursor: pointer; }

label > [type='checkbox'],
label > [type='radio'] {
  margin-right: 0; }

[type='file'] {
  width: 100%; }

label {
  display: block;
  margin: 0;
  font-size: 0.875rem;
  font-weight: normal;
  line-height: 1.5;
  color: #757575; }
  label.middle {
    margin: 0 0 0;
    padding: 0.0625rem 0; }

.help-text {
  margin-top: 0;
  font-size: 0.875rem;
  font-style: italic;
  color: #333; }

.input-group {
  display: table;
  width: 100%;
  margin-bottom: 0; }
  .input-group > :first-child, .input-group > :first-child.input-group-button > * {
    border-radius: 2px 0 0 2px; }
  .input-group > :last-child, .input-group > :last-child.input-group-button > * {
    border-radius: 0 2px 2px 0; }

.input-group-label, .input-group-field, .input-group-button, .input-group-button a,
.input-group-button input,
.input-group-button button,
.input-group-button label {
  margin: 0;
  white-space: nowrap;
  display: table-cell;
  vertical-align: middle; }

.input-group-label {
  padding: 0 1rem;
  border: 1px solid #aaa;
  background: #e3e3e3;
  color: #333;
  text-align: center;
  white-space: nowrap;
  width: 1%;
  height: 100%; }
  .input-group-label:first-child {
    border-right: 0; }
  .input-group-label:last-child {
    border-left: 0; }

.input-group-field {
  border-radius: 0; }

.input-group-button {
  padding-top: 0;
  padding-bottom: 0;
  text-align: center;
  width: 1%;
  height: 100%; }
  .input-group-button a,
  .input-group-button input,
  .input-group-button button,
  .input-group-button label {
    height: 2.9875rem;
    padding-top: 0;
    padding-bottom: 0;
    font-size: 1rem; }

.input-group .input-group-button {
  display: table-cell; }

fieldset {
  margin: 0;
  padding: 0;
  border: 0; }

legend {
  max-width: 100%;
  margin-bottom: 0; }

.fieldset {
  margin: 1.125rem 0;
  padding: 1.25rem;
  border: 1px solid #aaa; }
  .fieldset legend {
    margin: 0;
    margin-left: -0.1875rem;
    padding: 0 0.1875rem; }

select {
  height: 2.9875rem;
  margin: 0 0 0;
  padding: 0.825rem;
  -webkit-appearance: none;
     -moz-appearance: none;
          appearance: none;
  border: 1px solid transparent;
  border-radius: 2px;
  background-color: #fefefe;
  font-family: inherit;
  font-size: 1rem;
  font-weight: normal;
  line-height: 1.4;
  color: #333;
  background-image: url("data:image/svg+xml;utf8,<svg xmlns='http://www.w3.org/2000/svg' version='1.1' width='32' height='24' viewBox='0 0 32 24'><polygon points='0,0 32,0 16,24' style='fill: rgb%28117, 117, 117%29'></polygon></svg>");
  background-origin: content-box;
  background-position: right 0 center;
  background-repeat: no-repeat;
  background-size: 9px 6px;
  padding-right: 0;
  transition: box-shadow 0.5s, border-color 0.25s ease-in-out; }
  @media screen and (min-width: 0\0) {
    select {
      background-image: url("data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAACAAAAAYCAYAAACbU/80AAAAGXRFWHRTb2Z0d2FyZQBBZG9iZSBJbWFnZVJlYWR5ccllPAAAAIpJREFUeNrEkckNgDAMBBfRkEt0ObRBBdsGXUDgmQfK4XhH2m8czQAAy27R3tsw4Qfe2x8uOO6oYLb6GlOor3GF+swURAOmUJ+RwtEJs9WvTGEYxBXqI1MQAZhCfUQKRzDMVj+TwrAIV6jvSUEkYAr1LSkcyTBb/V+KYfX7xAeusq3sLDtGH3kEGACPWIflNZfhRQAAAABJRU5ErkJggg=="); } }
  select:focus {
    outline: none;
    border: 1px solid transparent;
    background-color: #fefefe;
    box-shadow: none;
    transition: box-shadow 0.5s, border-color 0.25s ease-in-out; }
  select:disabled {
    background-color: transparent;
    cursor: not-allowed; }
  select::-ms-expand {
    display: none; }
  select[multiple] {
    height: auto;
    background-image: none; }
  select:not([multiple]) {
    padding-top: 0;
    padding-bottom: 0; }

.is-invalid-input:not(:focus) {
  border-color: #cc4b37;
  background-color: #f9ecea; }
  .is-invalid-input:not(:focus):-ms-input-placeholder {
    color: #cc4b37; }
  .is-invalid-input:not(:focus)::placeholder {
    color: #cc4b37; }

.is-invalid-label {
  color: #cc4b37; }

.form-error {
  display: none;
  margin-top: 0;
  margin-bottom: 0;
  font-size: 0.875rem;
  font-weight: bold;
  color: #cc4b37; }
  .form-error.is-visible {
    display: block; }

.accordion {
  margin-left: 0;
  background: transparent;
  list-style-type: none; }
  .accordion[disabled] .accordion-title {
    cursor: not-allowed; }

.accordion-item:first-child > :first-child {
  border-radius: 2px 2px 0 0; }

.accordion-item:last-child > :last-child {
  border-radius: 0 0 2px 2px; }

.accordion-title {
  position: relative;
  display: block;
  padding: 1rem;
  border: none;
  border-bottom: 0;
  font-size: none;
  line-height: 1;
  color: #333;
  text-decoration: none; }
  :last-child:not(.is-active) > .accordion-title {
    border-bottom: none;
    border-radius: 0 0 2px 2px; }
  .accordion-title:hover, .accordion-title:focus {
    background-color: #e3e3e3; }
  .accordion-title::before {
    position: absolute;
    top: 50%;
    right: 1rem;
    margin-top: -0.5rem;
    content: "+"; }
  .is-active > .accordion-title::before {
    content: "–"; }

.accordion-content {
  display: none;
  padding: 0 1rem 1rem;
  border: none;
  border-bottom: 0;
  background-color: #fefefe;
  color: #333333; }
  :last-child > .accordion-content:last-child {
    border-bottom: none; }

.breadcrumbs {
  margin: 0 0 0 0;
  list-style: none; }
  .breadcrumbs::before, .breadcrumbs::after {
    display: table;
    content: ' '; }
  .breadcrumbs::after {
    clear: both; }
  .breadcrumbs li {
    float: left;
    font-size: 1rem;
    color: #333;
    cursor: default; }
    .breadcrumbs li:not(:last-child)::after {
      position: relative;
      margin: 0 0.5rem;
      opacity: 1;
      content: "/";
      color: #aaa; }
  .breadcrumbs a {
    color: #e75635; }
    .breadcrumbs a:hover {
      text-decoration: underline; }
  .breadcrumbs .disabled {
    color: #aaa;
    cursor: not-allowed; }

.card {
  margin-bottom: 0;
  border: none;
  border-radius: 2px;
  background: #fefefe;
  box-shadow: none;
  overflow: hidden;
  color: #333333; }
  .card > :last-child {
    margin-bottom: 0; }

.card-divider {
  padding: 1rem;
  background: #e3e3e3; }
  .card-divider > :last-child {
    margin-bottom: 0; }

.card-section {
  padding: 1rem; }
  .card-section > :last-child {
    margin-bottom: 0; }

.card-image {
  min-height: 1px; }

.close-button {
  position: absolute;
  z-index: 10;
  color: #757575;
  cursor: pointer; }
  [data-whatinput='mouse'] .close-button {
    outline: 0; }
  .close-button:hover, .close-button:focus {
    color: #333; }
  .close-button.small {
    right: 0.66rem;
    top: 0.33em;
    font-size: 1.5em;
    line-height: 1; }
  .close-button.medium, .close-button {
    right: 1rem;
    top: 0.5rem;
    font-size: 2em;
    line-height: 1; }

.menu {
  padding: 0;
  margin: 0;
  list-style: none;
  position: relative; }
  [data-whatinput='mouse'] .menu li {
    outline: 0; }
  .menu a,
  .menu .button {
    line-height: 1;
    text-decoration: none;
    display: block;
    padding: 0.75rem; }
  .menu input,
  .menu select,
  .menu a,
  .menu button {
    margin-bottom: 0; }
  .menu input {
    display: inline-block; }
  .menu li, .menu.horizontal li {
    display: inline-block; }
  .menu.vertical li {
    display: block; }
  .menu.expanded {
    display: table;
    width: 100%; }
    .menu.expanded > li {
      display: table-cell;
      vertical-align: middle; }
  .menu.simple li + li {
    margin-left: 1rem; }
  .menu.simple a {
    padding: 0; }
  @media print, screen and (min-width: 40em) {
    .menu.medium-horizontal li {
      display: inline-block; }
    .menu.medium-vertical li {
      display: block; }
    .menu.medium-expanded {
      display: table;
      width: 100%; }
      .menu.medium-expanded > li {
        display: table-cell;
        vertical-align: middle; }
    .menu.medium-simple {
      display: table;
      width: 100%; }
      .menu.medium-simple > li {
        display: table-cell;
        vertical-align: middle; } }
  @media print, screen and (min-width: 60em) {
    .menu.large-horizontal li {
      display: inline-block; }
    .menu.large-vertical li {
      display: block; }
    .menu.large-expanded {
      display: table;
      width: 100%; }
      .menu.large-expanded > li {
        display: table-cell;
        vertical-align: middle; }
    .menu.large-simple {
      display: table;
      width: 100%; }
      .menu.large-simple > li {
        display: table-cell;
        vertical-align: middle; } }
  @media screen and (min-width: 80em) {
    .menu.xlarge-horizontal li {
      display: inline-block; }
    .menu.xlarge-vertical li {
      display: block; }
    .menu.xlarge-expanded {
      display: table;
      width: 100%; }
      .menu.xlarge-expanded > li {
        display: table-cell;
        vertical-align: middle; }
    .menu.xlarge-simple {
      display: table;
      width: 100%; }
      .menu.xlarge-simple > li {
        display: table-cell;
        vertical-align: middle; } }
  @media screen and (min-width: 100em) {
    .menu.xxlarge-horizontal li {
      display: inline-block; }
    .menu.xxlarge-vertical li {
      display: block; }
    .menu.xxlarge-expanded {
      display: table;
      width: 100%; }
      .menu.xxlarge-expanded > li {
        display: table-cell;
        vertical-align: middle; }
    .menu.xxlarge-simple {
      display: table;
      width: 100%; }
      .menu.xxlarge-simple > li {
        display: table-cell;
        vertical-align: middle; } }
  @media screen and (min-width: 120em) {
    .menu.xxxlarge-horizontal li {
      display: inline-block; }
    .menu.xxxlarge-vertical li {
      display: block; }
    .menu.xxxlarge-expanded {
      display: table;
      width: 100%; }
      .menu.xxxlarge-expanded > li {
        display: table-cell;
        vertical-align: middle; }
    .menu.xxxlarge-simple {
      display: table;
      width: 100%; }
      .menu.xxxlarge-simple > li {
        display: table-cell;
        vertical-align: middle; } }
  .menu.nested {
    margin-right: 0;
    margin-left: 1rem; }
  .menu.icons img,
  .menu.icons i,
  .menu.icons svg {
    vertical-align: middle; }
    .menu.icons img + span,
    .menu.icons i + span,
    .menu.icons svg + span {
      vertical-align: middle; }
  .menu.icon-top img,
  .menu.icon-top i,
  .menu.icon-top svg, .menu.icon-right img,
  .menu.icon-right i,
  .menu.icon-right svg, .menu.icon-bottom img,
  .menu.icon-bottom i,
  .menu.icon-bottom svg, .menu.icon-left img,
  .menu.icon-left i,
  .menu.icon-left svg {
    vertical-align: middle; }
    .menu.icon-top img + span,
    .menu.icon-top i + span,
    .menu.icon-top svg + span, .menu.icon-right img + span,
    .menu.icon-right i + span,
    .menu.icon-right svg + span, .menu.icon-bottom img + span,
    .menu.icon-bottom i + span,
    .menu.icon-bottom svg + span, .menu.icon-left img + span,
    .menu.icon-left i + span,
    .menu.icon-left svg + span {
      vertical-align: middle; }
  .menu.icon-left li a img,
  .menu.icon-left li a i,
  .menu.icon-left li a svg {
    margin-right: 0.25rem;
    display: inline-block; }
  .menu.icon-right li a img,
  .menu.icon-right li a i,
  .menu.icon-right li a svg {
    margin-left: 0.25rem;
    display: inline-block; }
  .menu.icon-top li a {
    text-align: center; }
    .menu.icon-top li a img,
    .menu.icon-top li a i,
    .menu.icon-top li a svg {
      display: block;
      margin: 0 auto 0.25rem; }
  .menu.icon-bottom li a {
    text-align: center; }
    .menu.icon-bottom li a img,
    .menu.icon-bottom li a i,
    .menu.icon-bottom li a svg {
      display: block;
      margin: 0.25rem auto 0; }
  .menu .is-active > a {
    background: #fefefe;
    color: #333; }
  .menu .active > a {
    background: #fefefe;
    color: #333; }
  .menu.align-left {
    text-align: left; }
  .menu.align-right {
    text-align: right; }
    .menu.align-right .submenu li {
      text-align: left; }
    .menu.align-right.vertical .submenu li {
      text-align: right; }
    .menu.align-right .nested {
      margin-right: 1rem;
      margin-left: 0; }
  .menu.align-center {
    text-align: center; }
    .menu.align-center .submenu li {
      text-align: left; }
  .menu .menu-text {
    padding: 0.75rem;
    font-weight: bold;
    line-height: 1;
    color: inherit; }

.menu-centered > .menu {
  text-align: center; }
  .menu-centered > .menu .submenu li {
    text-align: left; }

.no-js [data-responsive-menu] ul {
  display: none; }

.menu-icon {
  position: relative;
  display: inline-block;
  vertical-align: middle;
  width: 20px;
  height: 16px;
  cursor: pointer; }
  .menu-icon::after {
    position: absolute;
    top: 0;
    left: 0;
    display: block;
    width: 100%;
    height: 2px;
    background: #333;
    box-shadow: 0 7px 0 #333, 0 14px 0 #333;
    content: ''; }
  .menu-icon:hover::after {
    background: #aaa;
    box-shadow: 0 7px 0 #aaa, 0 14px 0 #aaa; }

.menu-icon.dark {
  position: relative;
  display: inline-block;
  vertical-align: middle;
  width: 20px;
  height: 16px;
  cursor: pointer; }
  .menu-icon.dark::after {
    position: absolute;
    top: 0;
    left: 0;
    display: block;
    width: 100%;
    height: 2px;
    background: #333;
    box-shadow: 0 7px 0 #333, 0 14px 0 #333;
    content: ''; }
  .menu-icon.dark:hover::after {
    background: #757575;
    box-shadow: 0 7px 0 #757575, 0 14px 0 #757575; }

.is-drilldown {
  position: relative;
  overflow: hidden; }
  .is-drilldown li {
    display: block; }
  .is-drilldown.animate-height {
    transition: height 0.5s; }

.drilldown a {
  padding: 0.75rem;
  background: transparent; }

.drilldown .is-drilldown-submenu {
  position: absolute;
  top: 0;
  left: 100%;
  z-index: -1;
  width: 100%;
  background: #fefefe;
  transition: transform 0.15s linear; }
  .drilldown .is-drilldown-submenu.is-active {
    z-index: 1;
    display: block;
    -ms-transform: translateX(-100%);
        transform: translateX(-100%); }
  .drilldown .is-drilldown-submenu.is-closing {
    -ms-transform: translateX(100%);
        transform: translateX(100%); }
  .drilldown .is-drilldown-submenu a {
    padding: 0.75rem; }

.drilldown .nested.is-drilldown-submenu {
  margin-right: 0;
  margin-left: 0; }

.drilldown .drilldown-submenu-cover-previous {
  min-height: 100%; }

.drilldown .is-drilldown-submenu-parent > a {
  position: relative; }
  .drilldown .is-drilldown-submenu-parent > a::after {
    display: block;
    width: 0;
    height: 0;
    border: inset 6px;
    content: '';
    border-right-width: 0;
    border-left-style: solid;
    border-color: transparent transparent transparent #333;
    position: absolute;
    top: 50%;
    margin-top: -6px;
    right: 1rem; }

.drilldown.align-left .is-drilldown-submenu-parent > a::after {
  display: block;
  width: 0;
  height: 0;
  border: inset 6px;
  content: '';
  border-right-width: 0;
  border-left-style: solid;
  border-color: transparent transparent transparent #333;
  right: 1rem;
  left: auto; }

.drilldown.align-right .is-drilldown-submenu-parent > a::after {
  display: block;
  width: 0;
  height: 0;
  border: inset 6px;
  content: '';
  border-left-width: 0;
  border-right-style: solid;
  border-color: transparent #333 transparent transparent;
  right: auto;
  left: 1rem; }

.drilldown .js-drilldown-back > a::before {
  display: block;
  width: 0;
  height: 0;
  border: inset 6px;
  content: '';
  border-left-width: 0;
  border-right-style: solid;
  border-color: transparent #333 transparent transparent;
  display: inline-block;
  vertical-align: middle;
  margin-right: 0.75rem; }

.dropdown-pane {
  position: absolute;
  z-index: 10;
  display: none;
  width: 300px;
  padding: 0.5rem 0.75rem;
  visibility: hidden;
  border: none;
  border-radius: 2px;
  background-color: #fefefe;
  font-size: 0.875rem; }
  .dropdown-pane.is-opening {
    display: block; }
  .dropdown-pane.is-open {
    display: block;
    visibility: visible; }

.dropdown-pane.tiny {
  width: 100px; }

.dropdown-pane.small {
  width: 160px; }

.dropdown-pane.large {
  width: 400px; }

.dropdown.menu > li.opens-left > .is-dropdown-submenu {
  top: 100%;
  right: 0;
  left: auto; }

.dropdown.menu > li.opens-right > .is-dropdown-submenu {
  top: 100%;
  right: auto;
  left: 0; }

.dropdown.menu > li.is-dropdown-submenu-parent > a {
  position: relative;
  padding-right: 1.5rem; }

.dropdown.menu > li.is-dropdown-submenu-parent > a::after {
  display: block;
  width: 0;
  height: 0;
  border: inset 6px;
  content: '';
  border-bottom-width: 0;
  border-top-style: solid;
  border-color: #333 transparent transparent;
  right: 5px;
  left: auto;
  margin-top: -3px; }

[data-whatinput='mouse'] .dropdown.menu a {
  outline: 0; }

.dropdown.menu > li > a {
  background: transparent;
  padding: 0.75rem; }

.dropdown.menu > li.is-active > a {
  background: transparent;
  color: #333; }

.no-js .dropdown.menu ul {
  display: none; }

.dropdown.menu .nested.is-dropdown-submenu {
  margin-right: 0;
  margin-left: 0; }

.dropdown.menu.vertical > li .is-dropdown-submenu {
  top: 0; }

.dropdown.menu.vertical > li.opens-left > .is-dropdown-submenu {
  top: 0;
  right: 100%;
  left: auto; }

.dropdown.menu.vertical > li.opens-right > .is-dropdown-submenu {
  right: auto;
  left: 100%; }

.dropdown.menu.vertical > li > a::after {
  right: 14px; }

.dropdown.menu.vertical > li.opens-left > a::after {
  display: block;
  width: 0;
  height: 0;
  border: inset 6px;
  content: '';
  border-left-width: 0;
  border-right-style: solid;
  border-color: transparent #333 transparent transparent;
  right: auto;
  left: 5px; }

.dropdown.menu.vertical > li.opens-right > a::after {
  display: block;
  width: 0;
  height: 0;
  border: inset 6px;
  content: '';
  border-right-width: 0;
  border-left-style: solid;
  border-color: transparent transparent transparent #333; }

@media print, screen and (min-width: 40em) {
  .dropdown.menu.medium-horizontal > li.opens-left > .is-dropdown-submenu {
    top: 100%;
    right: 0;
    left: auto; }
  .dropdown.menu.medium-horizontal > li.opens-right > .is-dropdown-submenu {
    top: 100%;
    right: auto;
    left: 0; }
  .dropdown.menu.medium-horizontal > li.is-dropdown-submenu-parent > a {
    position: relative;
    padding-right: 1.5rem; }
  .dropdown.menu.medium-horizontal > li.is-dropdown-submenu-parent > a::after {
    display: block;
    width: 0;
    height: 0;
    border: inset 6px;
    content: '';
    border-bottom-width: 0;
    border-top-style: solid;
    border-color: #333 transparent transparent;
    right: 5px;
    left: auto;
    margin-top: -3px; }
  .dropdown.menu.medium-vertical > li .is-dropdown-submenu {
    top: 0; }
  .dropdown.menu.medium-vertical > li.opens-left > .is-dropdown-submenu {
    top: 0;
    right: 100%;
    left: auto; }
  .dropdown.menu.medium-vertical > li.opens-right > .is-dropdown-submenu {
    right: auto;
    left: 100%; }
  .dropdown.menu.medium-vertical > li > a::after {
    right: 14px; }
  .dropdown.menu.medium-vertical > li.opens-left > a::after {
    display: block;
    width: 0;
    height: 0;
    border: inset 6px;
    content: '';
    border-left-width: 0;
    border-right-style: solid;
    border-color: transparent #333 transparent transparent;
    right: auto;
    left: 5px; }
  .dropdown.menu.medium-vertical > li.opens-right > a::after {
    display: block;
    width: 0;
    height: 0;
    border: inset 6px;
    content: '';
    border-right-width: 0;
    border-left-style: solid;
    border-color: transparent transparent transparent #333; } }

@media print, screen and (min-width: 60em) {
  .dropdown.menu.large-horizontal > li.opens-left > .is-dropdown-submenu {
    top: 100%;
    right: 0;
    left: auto; }
  .dropdown.menu.large-horizontal > li.opens-right > .is-dropdown-submenu {
    top: 100%;
    right: auto;
    left: 0; }
  .dropdown.menu.large-horizontal > li.is-dropdown-submenu-parent > a {
    position: relative;
    padding-right: 1.5rem; }
  .dropdown.menu.large-horizontal > li.is-dropdown-submenu-parent > a::after {
    display: block;
    width: 0;
    height: 0;
    border: inset 6px;
    content: '';
    border-bottom-width: 0;
    border-top-style: solid;
    border-color: #333 transparent transparent;
    right: 5px;
    left: auto;
    margin-top: -3px; }
  .dropdown.menu.large-vertical > li .is-dropdown-submenu {
    top: 0; }
  .dropdown.menu.large-vertical > li.opens-left > .is-dropdown-submenu {
    top: 0;
    right: 100%;
    left: auto; }
  .dropdown.menu.large-vertical > li.opens-right > .is-dropdown-submenu {
    right: auto;
    left: 100%; }
  .dropdown.menu.large-vertical > li > a::after {
    right: 14px; }
  .dropdown.menu.large-vertical > li.opens-left > a::after {
    display: block;
    width: 0;
    height: 0;
    border: inset 6px;
    content: '';
    border-left-width: 0;
    border-right-style: solid;
    border-color: transparent #333 transparent transparent;
    right: auto;
    left: 5px; }
  .dropdown.menu.large-vertical > li.opens-right > a::after {
    display: block;
    width: 0;
    height: 0;
    border: inset 6px;
    content: '';
    border-right-width: 0;
    border-left-style: solid;
    border-color: transparent transparent transparent #333; } }

@media screen and (min-width: 80em) {
  .dropdown.menu.xlarge-horizontal > li.opens-left > .is-dropdown-submenu {
    top: 100%;
    right: 0;
    left: auto; }
  .dropdown.menu.xlarge-horizontal > li.opens-right > .is-dropdown-submenu {
    top: 100%;
    right: auto;
    left: 0; }
  .dropdown.menu.xlarge-horizontal > li.is-dropdown-submenu-parent > a {
    position: relative;
    padding-right: 1.5rem; }
  .dropdown.menu.xlarge-horizontal > li.is-dropdown-submenu-parent > a::after {
    display: block;
    width: 0;
    height: 0;
    border: inset 6px;
    content: '';
    border-bottom-width: 0;
    border-top-style: solid;
    border-color: #333 transparent transparent;
    right: 5px;
    left: auto;
    margin-top: -3px; }
  .dropdown.menu.xlarge-vertical > li .is-dropdown-submenu {
    top: 0; }
  .dropdown.menu.xlarge-vertical > li.opens-left > .is-dropdown-submenu {
    top: 0;
    right: 100%;
    left: auto; }
  .dropdown.menu.xlarge-vertical > li.opens-right > .is-dropdown-submenu {
    right: auto;
    left: 100%; }
  .dropdown.menu.xlarge-vertical > li > a::after {
    right: 14px; }
  .dropdown.menu.xlarge-vertical > li.opens-left > a::after {
    display: block;
    width: 0;
    height: 0;
    border: inset 6px;
    content: '';
    border-left-width: 0;
    border-right-style: solid;
    border-color: transparent #333 transparent transparent;
    right: auto;
    left: 5px; }
  .dropdown.menu.xlarge-vertical > li.opens-right > a::after {
    display: block;
    width: 0;
    height: 0;
    border: inset 6px;
    content: '';
    border-right-width: 0;
    border-left-style: solid;
    border-color: transparent transparent transparent #333; } }

@media screen and (min-width: 100em) {
  .dropdown.menu.xxlarge-horizontal > li.opens-left > .is-dropdown-submenu {
    top: 100%;
    right: 0;
    left: auto; }
  .dropdown.menu.xxlarge-horizontal > li.opens-right > .is-dropdown-submenu {
    top: 100%;
    right: auto;
    left: 0; }
  .dropdown.menu.xxlarge-horizontal > li.is-dropdown-submenu-parent > a {
    position: relative;
    padding-right: 1.5rem; }
  .dropdown.menu.xxlarge-horizontal > li.is-dropdown-submenu-parent > a::after {
    display: block;
    width: 0;
    height: 0;
    border: inset 6px;
    content: '';
    border-bottom-width: 0;
    border-top-style: solid;
    border-color: #333 transparent transparent;
    right: 5px;
    left: auto;
    margin-top: -3px; }
  .dropdown.menu.xxlarge-vertical > li .is-dropdown-submenu {
    top: 0; }
  .dropdown.menu.xxlarge-vertical > li.opens-left > .is-dropdown-submenu {
    top: 0;
    right: 100%;
    left: auto; }
  .dropdown.menu.xxlarge-vertical > li.opens-right > .is-dropdown-submenu {
    right: auto;
    left: 100%; }
  .dropdown.menu.xxlarge-vertical > li > a::after {
    right: 14px; }
  .dropdown.menu.xxlarge-vertical > li.opens-left > a::after {
    display: block;
    width: 0;
    height: 0;
    border: inset 6px;
    content: '';
    border-left-width: 0;
    border-right-style: solid;
    border-color: transparent #333 transparent transparent;
    right: auto;
    left: 5px; }
  .dropdown.menu.xxlarge-vertical > li.opens-right > a::after {
    display: block;
    width: 0;
    height: 0;
    border: inset 6px;
    content: '';
    border-right-width: 0;
    border-left-style: solid;
    border-color: transparent transparent transparent #333; } }

@media screen and (min-width: 120em) {
  .dropdown.menu.xxxlarge-horizontal > li.opens-left > .is-dropdown-submenu {
    top: 100%;
    right: 0;
    left: auto; }
  .dropdown.menu.xxxlarge-horizontal > li.opens-right > .is-dropdown-submenu {
    top: 100%;
    right: auto;
    left: 0; }
  .dropdown.menu.xxxlarge-horizontal > li.is-dropdown-submenu-parent > a {
    position: relative;
    padding-right: 1.5rem; }
  .dropdown.menu.xxxlarge-horizontal > li.is-dropdown-submenu-parent > a::after {
    display: block;
    width: 0;
    height: 0;
    border: inset 6px;
    content: '';
    border-bottom-width: 0;
    border-top-style: solid;
    border-color: #333 transparent transparent;
    right: 5px;
    left: auto;
    margin-top: -3px; }
  .dropdown.menu.xxxlarge-vertical > li .is-dropdown-submenu {
    top: 0; }
  .dropdown.menu.xxxlarge-vertical > li.opens-left > .is-dropdown-submenu {
    top: 0;
    right: 100%;
    left: auto; }
  .dropdown.menu.xxxlarge-vertical > li.opens-right > .is-dropdown-submenu {
    right: auto;
    left: 100%; }
  .dropdown.menu.xxxlarge-vertical > li > a::after {
    right: 14px; }
  .dropdown.menu.xxxlarge-vertical > li.opens-left > a::after {
    display: block;
    width: 0;
    height: 0;
    border: inset 6px;
    content: '';
    border-left-width: 0;
    border-right-style: solid;
    border-color: transparent #333 transparent transparent;
    right: auto;
    left: 5px; }
  .dropdown.menu.xxxlarge-vertical > li.opens-right > a::after {
    display: block;
    width: 0;
    height: 0;
    border: inset 6px;
    content: '';
    border-right-width: 0;
    border-left-style: solid;
    border-color: transparent transparent transparent #333; } }

.dropdown.menu.align-right .is-dropdown-submenu.first-sub {
  top: 100%;
  right: 0;
  left: auto; }

.is-dropdown-menu.vertical {
  width: 100px; }
  .is-dropdown-menu.vertical.align-right {
    float: right; }

.is-dropdown-submenu-parent {
  position: relative; }
  .is-dropdown-submenu-parent a::after {
    position: absolute;
    top: 50%;
    right: 5px;
    left: auto;
    margin-top: -6px; }
  .is-dropdown-submenu-parent.opens-inner > .is-dropdown-submenu {
    top: 100%;
    left: auto; }
  .is-dropdown-submenu-parent.opens-left > .is-dropdown-submenu {
    right: 100%;
    left: auto; }
  .is-dropdown-submenu-parent.opens-right > .is-dropdown-submenu {
    right: auto;
    left: 100%; }

.is-dropdown-submenu {
  position: absolute;
  top: 0;
  left: 100%;
  z-index: 1;
  display: none;
  min-width: 200px;
  border: none;
  background: transparent; }
  .dropdown .is-dropdown-submenu a {
    padding: 0.75rem; }
  .is-dropdown-submenu .is-dropdown-submenu-parent > a::after {
    right: 14px; }
  .is-dropdown-submenu .is-dropdown-submenu-parent.opens-left > a::after {
    display: block;
    width: 0;
    height: 0;
    border: inset 6px;
    content: '';
    border-left-width: 0;
    border-right-style: solid;
    border-color: transparent #333 transparent transparent;
    right: auto;
    left: 5px; }
  .is-dropdown-submenu .is-dropdown-submenu-parent.opens-right > a::after {
    display: block;
    width: 0;
    height: 0;
    border: inset 6px;
    content: '';
    border-right-width: 0;
    border-left-style: solid;
    border-color: transparent transparent transparent #333; }
  .is-dropdown-submenu > li {
    width: 100%; }
  .is-dropdown-submenu.js-dropdown-active {
    display: block; }

.label {
  display: inline-block;
  padding: 0.33333rem 0.5rem;
  border-radius: 2px;
  font-size: 0.8rem;
  line-height: 1;
  white-space: nowrap;
  cursor: default;
  background: #e75635;
  color: #fefefe; }
  .label.primary {
    background: #e75635;
    color: #fefefe; }
  .label.secondary {
    background: #50aaeb;
    color: #333; }
  .label.success {
    background: #66c17b;
    color: #333; }
  .label.warning {
    background: #ffae00;
    color: #333; }
  .label.alert {
    background: #cc4b37;
    color: #fefefe; }

.is-off-canvas-open {
  overflow: hidden; }

.js-off-canvas-overlay {
  position: absolute;
  top: 0;
  left: 0;
  z-index: 11;
  width: 100%;
  height: 100%;
  transition: opacity 0.5s ease, visibility 0.5s ease;
  background: rgba(254, 254, 254, 0.25);
  opacity: 0;
  visibility: hidden;
  overflow: hidden; }
  .js-off-canvas-overlay.is-visible {
    opacity: 1;
    visibility: visible; }
  .js-off-canvas-overlay.is-closable {
    cursor: pointer; }
  .js-off-canvas-overlay.is-overlay-absolute {
    position: absolute; }
  .js-off-canvas-overlay.is-overlay-fixed {
    position: fixed; }

.off-canvas-wrapper {
  position: relative;
  overflow: hidden; }

.off-canvas {
  position: fixed;
  z-index: 12;
  transition: transform 0.5s ease;
  backface-visibility: hidden;
  background: #e3e3e3; }
  [data-whatinput='mouse'] .off-canvas {
    outline: 0; }
  .off-canvas.is-transition-push {
    z-index: 12; }
  .off-canvas.is-closed {
    visibility: hidden; }
  .off-canvas.is-transition-overlap {
    z-index: 13; }
    .off-canvas.is-transition-overlap.is-open {
      box-shadow: 0 0 10px rgba(51, 51, 51, 0.7); }
  .off-canvas.is-open {
    -ms-transform: translate(0, 0);
        transform: translate(0, 0); }

.off-canvas-absolute {
  position: absolute;
  z-index: 12;
  transition: transform 0.5s ease;
  backface-visibility: hidden;
  background: #e3e3e3; }
  [data-whatinput='mouse'] .off-canvas-absolute {
    outline: 0; }
  .off-canvas-absolute.is-transition-push {
    z-index: 12; }
  .off-canvas-absolute.is-closed {
    visibility: hidden; }
  .off-canvas-absolute.is-transition-overlap {
    z-index: 13; }
    .off-canvas-absolute.is-transition-overlap.is-open {
      box-shadow: 0 0 10px rgba(51, 51, 51, 0.7); }
  .off-canvas-absolute.is-open {
    -ms-transform: translate(0, 0);
        transform: translate(0, 0); }

.position-left {
  top: 0;
  left: 0;
  height: 100%;
  overflow-y: auto;
  width: 250px;
  -ms-transform: translateX(-250px);
      transform: translateX(-250px); }
  .off-canvas-content .off-canvas.position-left {
    -ms-transform: translateX(-250px);
        transform: translateX(-250px); }
    .off-canvas-content .off-canvas.position-left.is-transition-overlap.is-open {
      -ms-transform: translate(0, 0);
          transform: translate(0, 0); }
  .off-canvas-content.is-open-left.has-transition-push {
    -ms-transform: translateX(250px);
        transform: translateX(250px); }
  .position-left.is-transition-push {
    box-shadow: inset -13px 0 20px -13px rgba(51, 51, 51, 0.25); }

.position-right {
  top: 0;
  right: 0;
  height: 100%;
  overflow-y: auto;
  width: 250px;
  -ms-transform: translateX(250px);
      transform: translateX(250px); }
  .off-canvas-content .off-canvas.position-right {
    -ms-transform: translateX(250px);
        transform: translateX(250px); }
    .off-canvas-content .off-canvas.position-right.is-transition-overlap.is-open {
      -ms-transform: translate(0, 0);
          transform: translate(0, 0); }
  .off-canvas-content.is-open-right.has-transition-push {
    -ms-transform: translateX(-250px);
        transform: translateX(-250px); }
  .position-right.is-transition-push {
    box-shadow: inset 13px 0 20px -13px rgba(51, 51, 51, 0.25); }

.position-top {
  top: 0;
  left: 0;
  width: 100%;
  overflow-x: auto;
  height: 250px;
  -ms-transform: translateY(-250px);
      transform: translateY(-250px); }
  .off-canvas-content .off-canvas.position-top {
    -ms-transform: translateY(-250px);
        transform: translateY(-250px); }
    .off-canvas-content .off-canvas.position-top.is-transition-overlap.is-open {
      -ms-transform: translate(0, 0);
          transform: translate(0, 0); }
  .off-canvas-content.is-open-top.has-transition-push {
    -ms-transform: translateY(250px);
        transform: translateY(250px); }
  .position-top.is-transition-push {
    box-shadow: inset 0 -13px 20px -13px rgba(51, 51, 51, 0.25); }

.position-bottom {
  bottom: 0;
  left: 0;
  width: 100%;
  overflow-x: auto;
  height: 250px;
  -ms-transform: translateY(250px);
      transform: translateY(250px); }
  .off-canvas-content .off-canvas.position-bottom {
    -ms-transform: translateY(250px);
        transform: translateY(250px); }
    .off-canvas-content .off-canvas.position-bottom.is-transition-overlap.is-open {
      -ms-transform: translate(0, 0);
          transform: translate(0, 0); }
  .off-canvas-content.is-open-bottom.has-transition-push {
    -ms-transform: translateY(-250px);
        transform: translateY(-250px); }
  .position-bottom.is-transition-push {
    box-shadow: inset 0 13px 20px -13px rgba(51, 51, 51, 0.25); }

.off-canvas-content {
  -ms-transform: none;
      transform: none;
  backface-visibility: hidden; }
  .off-canvas-content.has-transition-overlap, .off-canvas-content.has-transition-push {
    transition: transform 0.5s ease; }
  .off-canvas-content.has-transition-push {
    -ms-transform: translate(0, 0);
        transform: translate(0, 0); }
  .off-canvas-content .off-canvas.is-open {
    -ms-transform: translate(0, 0);
        transform: translate(0, 0); }

@media print, screen and (min-width: 40em) {
  .position-left.reveal-for-medium {
    -ms-transform: none;
        transform: none;
    z-index: 12;
    transition: none;
    visibility: visible; }
    .position-left.reveal-for-medium .close-button {
      display: none; }
    .off-canvas-content .position-left.reveal-for-medium {
      -ms-transform: none;
          transform: none; }
    .off-canvas-content.has-reveal-left {
      margin-left: 250px; }
    .position-left.reveal-for-medium ~ .off-canvas-content {
      margin-left: 250px; }
  .position-right.reveal-for-medium {
    -ms-transform: none;
        transform: none;
    z-index: 12;
    transition: none;
    visibility: visible; }
    .position-right.reveal-for-medium .close-button {
      display: none; }
    .off-canvas-content .position-right.reveal-for-medium {
      -ms-transform: none;
          transform: none; }
    .off-canvas-content.has-reveal-right {
      margin-right: 250px; }
    .position-right.reveal-for-medium ~ .off-canvas-content {
      margin-right: 250px; }
  .position-top.reveal-for-medium {
    -ms-transform: none;
        transform: none;
    z-index: 12;
    transition: none;
    visibility: visible; }
    .position-top.reveal-for-medium .close-button {
      display: none; }
    .off-canvas-content .position-top.reveal-for-medium {
      -ms-transform: none;
          transform: none; }
    .off-canvas-content.has-reveal-top {
      margin-top: 250px; }
    .position-top.reveal-for-medium ~ .off-canvas-content {
      margin-top: 250px; }
  .position-bottom.reveal-for-medium {
    -ms-transform: none;
        transform: none;
    z-index: 12;
    transition: none;
    visibility: visible; }
    .position-bottom.reveal-for-medium .close-button {
      display: none; }
    .off-canvas-content .position-bottom.reveal-for-medium {
      -ms-transform: none;
          transform: none; }
    .off-canvas-content.has-reveal-bottom {
      margin-bottom: 250px; }
    .position-bottom.reveal-for-medium ~ .off-canvas-content {
      margin-bottom: 250px; } }

@media print, screen and (min-width: 60em) {
  .position-left.reveal-for-large {
    -ms-transform: none;
        transform: none;
    z-index: 12;
    transition: none;
    visibility: visible; }
    .position-left.reveal-for-large .close-button {
      display: none; }
    .off-canvas-content .position-left.reveal-for-large {
      -ms-transform: none;
          transform: none; }
    .off-canvas-content.has-reveal-left {
      margin-left: 250px; }
    .position-left.reveal-for-large ~ .off-canvas-content {
      margin-left: 250px; }
  .position-right.reveal-for-large {
    -ms-transform: none;
        transform: none;
    z-index: 12;
    transition: none;
    visibility: visible; }
    .position-right.reveal-for-large .close-button {
      display: none; }
    .off-canvas-content .position-right.reveal-for-large {
      -ms-transform: none;
          transform: none; }
    .off-canvas-content.has-reveal-right {
      margin-right: 250px; }
    .position-right.reveal-for-large ~ .off-canvas-content {
      margin-right: 250px; }
  .position-top.reveal-for-large {
    -ms-transform: none;
        transform: none;
    z-index: 12;
    transition: none;
    visibility: visible; }
    .position-top.reveal-for-large .close-button {
      display: none; }
    .off-canvas-content .position-top.reveal-for-large {
      -ms-transform: none;
          transform: none; }
    .off-canvas-content.has-reveal-top {
      margin-top: 250px; }
    .position-top.reveal-for-large ~ .off-canvas-content {
      margin-top: 250px; }
  .position-bottom.reveal-for-large {
    -ms-transform: none;
        transform: none;
    z-index: 12;
    transition: none;
    visibility: visible; }
    .position-bottom.reveal-for-large .close-button {
      display: none; }
    .off-canvas-content .position-bottom.reveal-for-large {
      -ms-transform: none;
          transform: none; }
    .off-canvas-content.has-reveal-bottom {
      margin-bottom: 250px; }
    .position-bottom.reveal-for-large ~ .off-canvas-content {
      margin-bottom: 250px; } }

@media screen and (min-width: 80em) {
  .position-left.reveal-for-xlarge {
    -ms-transform: none;
        transform: none;
    z-index: 12;
    transition: none;
    visibility: visible; }
    .position-left.reveal-for-xlarge .close-button {
      display: none; }
    .off-canvas-content .position-left.reveal-for-xlarge {
      -ms-transform: none;
          transform: none; }
    .off-canvas-content.has-reveal-left {
      margin-left: 250px; }
    .position-left.reveal-for-xlarge ~ .off-canvas-content {
      margin-left: 250px; }
  .position-right.reveal-for-xlarge {
    -ms-transform: none;
        transform: none;
    z-index: 12;
    transition: none;
    visibility: visible; }
    .position-right.reveal-for-xlarge .close-button {
      display: none; }
    .off-canvas-content .position-right.reveal-for-xlarge {
      -ms-transform: none;
          transform: none; }
    .off-canvas-content.has-reveal-right {
      margin-right: 250px; }
    .position-right.reveal-for-xlarge ~ .off-canvas-content {
      margin-right: 250px; }
  .position-top.reveal-for-xlarge {
    -ms-transform: none;
        transform: none;
    z-index: 12;
    transition: none;
    visibility: visible; }
    .position-top.reveal-for-xlarge .close-button {
      display: none; }
    .off-canvas-content .position-top.reveal-for-xlarge {
      -ms-transform: none;
          transform: none; }
    .off-canvas-content.has-reveal-top {
      margin-top: 250px; }
    .position-top.reveal-for-xlarge ~ .off-canvas-content {
      margin-top: 250px; }
  .position-bottom.reveal-for-xlarge {
    -ms-transform: none;
        transform: none;
    z-index: 12;
    transition: none;
    visibility: visible; }
    .position-bottom.reveal-for-xlarge .close-button {
      display: none; }
    .off-canvas-content .position-bottom.reveal-for-xlarge {
      -ms-transform: none;
          transform: none; }
    .off-canvas-content.has-reveal-bottom {
      margin-bottom: 250px; }
    .position-bottom.reveal-for-xlarge ~ .off-canvas-content {
      margin-bottom: 250px; } }

@media screen and (min-width: 100em) {
  .position-left.reveal-for-xxlarge {
    -ms-transform: none;
        transform: none;
    z-index: 12;
    transition: none;
    visibility: visible; }
    .position-left.reveal-for-xxlarge .close-button {
      display: none; }
    .off-canvas-content .position-left.reveal-for-xxlarge {
      -ms-transform: none;
          transform: none; }
    .off-canvas-content.has-reveal-left {
      margin-left: 250px; }
    .position-left.reveal-for-xxlarge ~ .off-canvas-content {
      margin-left: 250px; }
  .position-right.reveal-for-xxlarge {
    -ms-transform: none;
        transform: none;
    z-index: 12;
    transition: none;
    visibility: visible; }
    .position-right.reveal-for-xxlarge .close-button {
      display: none; }
    .off-canvas-content .position-right.reveal-for-xxlarge {
      -ms-transform: none;
          transform: none; }
    .off-canvas-content.has-reveal-right {
      margin-right: 250px; }
    .position-right.reveal-for-xxlarge ~ .off-canvas-content {
      margin-right: 250px; }
  .position-top.reveal-for-xxlarge {
    -ms-transform: none;
        transform: none;
    z-index: 12;
    transition: none;
    visibility: visible; }
    .position-top.reveal-for-xxlarge .close-button {
      display: none; }
    .off-canvas-content .position-top.reveal-for-xxlarge {
      -ms-transform: none;
          transform: none; }
    .off-canvas-content.has-reveal-top {
      margin-top: 250px; }
    .position-top.reveal-for-xxlarge ~ .off-canvas-content {
      margin-top: 250px; }
  .position-bottom.reveal-for-xxlarge {
    -ms-transform: none;
        transform: none;
    z-index: 12;
    transition: none;
    visibility: visible; }
    .position-bottom.reveal-for-xxlarge .close-button {
      display: none; }
    .off-canvas-content .position-bottom.reveal-for-xxlarge {
      -ms-transform: none;
          transform: none; }
    .off-canvas-content.has-reveal-bottom {
      margin-bottom: 250px; }
    .position-bottom.reveal-for-xxlarge ~ .off-canvas-content {
      margin-bottom: 250px; } }

@media screen and (min-width: 120em) {
  .position-left.reveal-for-xxxlarge {
    -ms-transform: none;
        transform: none;
    z-index: 12;
    transition: none;
    visibility: visible; }
    .position-left.reveal-for-xxxlarge .close-button {
      display: none; }
    .off-canvas-content .position-left.reveal-for-xxxlarge {
      -ms-transform: none;
          transform: none; }
    .off-canvas-content.has-reveal-left {
      margin-left: 250px; }
    .position-left.reveal-for-xxxlarge ~ .off-canvas-content {
      margin-left: 250px; }
  .position-right.reveal-for-xxxlarge {
    -ms-transform: none;
        transform: none;
    z-index: 12;
    transition: none;
    visibility: visible; }
    .position-right.reveal-for-xxxlarge .close-button {
      display: none; }
    .off-canvas-content .position-right.reveal-for-xxxlarge {
      -ms-transform: none;
          transform: none; }
    .off-canvas-content.has-reveal-right {
      margin-right: 250px; }
    .position-right.reveal-for-xxxlarge ~ .off-canvas-content {
      margin-right: 250px; }
  .position-top.reveal-for-xxxlarge {
    -ms-transform: none;
        transform: none;
    z-index: 12;
    transition: none;
    visibility: visible; }
    .position-top.reveal-for-xxxlarge .close-button {
      display: none; }
    .off-canvas-content .position-top.reveal-for-xxxlarge {
      -ms-transform: none;
          transform: none; }
    .off-canvas-content.has-reveal-top {
      margin-top: 250px; }
    .position-top.reveal-for-xxxlarge ~ .off-canvas-content {
      margin-top: 250px; }
  .position-bottom.reveal-for-xxxlarge {
    -ms-transform: none;
        transform: none;
    z-index: 12;
    transition: none;
    visibility: visible; }
    .position-bottom.reveal-for-xxxlarge .close-button {
      display: none; }
    .off-canvas-content .position-bottom.reveal-for-xxxlarge {
      -ms-transform: none;
          transform: none; }
    .off-canvas-content.has-reveal-bottom {
      margin-bottom: 250px; }
    .position-bottom.reveal-for-xxxlarge ~ .off-canvas-content {
      margin-bottom: 250px; } }

@media print, screen and (min-width: 40em) {
  .off-canvas.in-canvas-for-medium {
    visibility: visible;
    height: auto;
    position: static;
    background: none;
    width: auto;
    overflow: visible;
    transition: none; }
    .off-canvas.in-canvas-for-medium.position-left, .off-canvas.in-canvas-for-medium.position-right, .off-canvas.in-canvas-for-medium.position-top, .off-canvas.in-canvas-for-medium.position-bottom {
      box-shadow: none;
      -ms-transform: none;
          transform: none; }
    .off-canvas.in-canvas-for-medium .close-button {
      display: none; } }

@media print, screen and (min-width: 60em) {
  .off-canvas.in-canvas-for-large {
    visibility: visible;
    height: auto;
    position: static;
    background: none;
    width: auto;
    overflow: visible;
    transition: none; }
    .off-canvas.in-canvas-for-large.position-left, .off-canvas.in-canvas-for-large.position-right, .off-canvas.in-canvas-for-large.position-top, .off-canvas.in-canvas-for-large.position-bottom {
      box-shadow: none;
      -ms-transform: none;
          transform: none; }
    .off-canvas.in-canvas-for-large .close-button {
      display: none; } }

@media screen and (min-width: 80em) {
  .off-canvas.in-canvas-for-xlarge {
    visibility: visible;
    height: auto;
    position: static;
    background: none;
    width: auto;
    overflow: visible;
    transition: none; }
    .off-canvas.in-canvas-for-xlarge.position-left, .off-canvas.in-canvas-for-xlarge.position-right, .off-canvas.in-canvas-for-xlarge.position-top, .off-canvas.in-canvas-for-xlarge.position-bottom {
      box-shadow: none;
      -ms-transform: none;
          transform: none; }
    .off-canvas.in-canvas-for-xlarge .close-button {
      display: none; } }

@media screen and (min-width: 100em) {
  .off-canvas.in-canvas-for-xxlarge {
    visibility: visible;
    height: auto;
    position: static;
    background: none;
    width: auto;
    overflow: visible;
    transition: none; }
    .off-canvas.in-canvas-for-xxlarge.position-left, .off-canvas.in-canvas-for-xxlarge.position-right, .off-canvas.in-canvas-for-xxlarge.position-top, .off-canvas.in-canvas-for-xxlarge.position-bottom {
      box-shadow: none;
      -ms-transform: none;
          transform: none; }
    .off-canvas.in-canvas-for-xxlarge .close-button {
      display: none; } }

@media screen and (min-width: 120em) {
  .off-canvas.in-canvas-for-xxxlarge {
    visibility: visible;
    height: auto;
    position: static;
    background: none;
    width: auto;
    overflow: visible;
    transition: none; }
    .off-canvas.in-canvas-for-xxxlarge.position-left, .off-canvas.in-canvas-for-xxxlarge.position-right, .off-canvas.in-canvas-for-xxxlarge.position-top, .off-canvas.in-canvas-for-xxxlarge.position-bottom {
      box-shadow: none;
      -ms-transform: none;
          transform: none; }
    .off-canvas.in-canvas-for-xxxlarge .close-button {
      display: none; } }

.progress {
  height: 1rem;
  margin-bottom: 1.5rem;
  border-radius: 2px;
  background-color: white; }
  .progress.primary .progress-meter {
    background-color: #e75635; }
  .progress.secondary .progress-meter {
    background-color: #50aaeb; }
  .progress.success .progress-meter {
    background-color: #66c17b; }
  .progress.warning .progress-meter {
    background-color: #ffae00; }
  .progress.alert .progress-meter {
    background-color: #cc4b37; }

.progress-meter {
  position: relative;
  display: block;
  width: 0%;
  height: 100%;
  background-color: #aaa;
  border-radius: 2px; }

.progress-meter-text {
  position: absolute;
  top: 50%;
  left: 50%;
  -ms-transform: translate(-50%, -50%);
      transform: translate(-50%, -50%);
  margin: 0;
  font-size: 0.75rem;
  font-weight: bold;
  color: #fefefe;
  white-space: nowrap;
  border-radius: 2px; }

.slider {
  position: relative;
  height: 0.5rem;
  margin-top: 1.25rem;
  margin-bottom: 2.25rem;
  background-color: #e3e3e3;
  cursor: pointer;
  -webkit-user-select: none;
     -moz-user-select: none;
      -ms-user-select: none;
          user-select: none;
  -ms-touch-action: none;
      touch-action: none; }

.slider-fill {
  position: absolute;
  top: 0;
  left: 0;
  display: inline-block;
  max-width: 100%;
  height: 0.5rem;
  background-color: #aaa;
  transition: all 0.2s ease-in-out; }
  .slider-fill.is-dragging {
    transition: all 0s linear; }

.slider-handle {
  position: absolute;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%);
  left: 0;
  z-index: 1;
  display: inline-block;
  width: 1.4rem;
  height: 1.4rem;
  border-radius: 2px;
  background-color: #e75635;
  transition: all 0.2s ease-in-out;
  -ms-touch-action: manipulation;
      touch-action: manipulation; }
  [data-whatinput='mouse'] .slider-handle {
    outline: 0; }
  .slider-handle:hover {
    background-color: #d83d1a; }
  .slider-handle.is-dragging {
    transition: all 0s linear; }

.slider.disabled,
.slider[disabled] {
  opacity: 0.25;
  cursor: not-allowed; }

.slider.vertical {
  display: inline-block;
  width: 0.5rem;
  height: 12.5rem;
  margin: 0 1.25rem;
  -ms-transform: scale(1, -1);
      transform: scale(1, -1); }
  .slider.vertical .slider-fill {
    top: 0;
    width: 0.5rem;
    max-height: 100%; }
  .slider.vertical .slider-handle {
    position: absolute;
    top: 0;
    left: 50%;
    width: 1.4rem;
    height: 1.4rem;
    -ms-transform: translateX(-50%);
        transform: translateX(-50%); }

html.is-reveal-open {
  position: fixed;
  width: 100%;
  overflow-y: hidden; }
  html.is-reveal-open.zf-has-scroll {
    overflow-y: scroll; }
  html.is-reveal-open body {
    overflow-y: hidden; }

.reveal-overlay {
  position: fixed;
  top: 0;
  right: 0;
  bottom: 0;
  left: 0;
  z-index: 600;
  display: none;
  background-color: rgba(254, 254, 254, 0.85);
  overflow-y: auto; }

.reveal {
  z-index: 601;
  backface-visibility: hidden;
  display: none;
  padding: 0;
  border: none;
  border-radius: 2px;
  background-color: #fefefe;
  position: relative;
  top: 100px;
  margin-right: auto;
  margin-left: auto;
  overflow-y: auto; }
  [data-whatinput='mouse'] .reveal {
    outline: 0; }
  @media print, screen and (min-width: 40em) {
    .reveal {
      min-height: 0; } }
  .reveal .column, .reveal .columns {
    min-width: 0; }
  .reveal > :last-child {
    margin-bottom: 0; }
  @media print, screen and (min-width: 40em) {
    .reveal {
      width: 600px;
      max-width: 75rem; } }
  .reveal.collapse {
    padding: 0; }
  @media print, screen and (min-width: 40em) {
    .reveal.tiny {
      width: 30%;
      max-width: 75rem; } }
  @media print, screen and (min-width: 40em) {
    .reveal.small {
      width: 50%;
      max-width: 75rem; } }
  @media print, screen and (min-width: 40em) {
    .reveal.large {
      width: 90%;
      max-width: 75rem; } }
  .reveal.full {
    top: 0;
    right: 0;
    bottom: 0;
    left: 0;
    width: 100%;
    max-width: none;
    height: 100%;
    min-height: 100%;
    margin-left: 0;
    border: 0;
    border-radius: 0; }
  @media print, screen and (max-width: 39.99875em) {
    .reveal {
      top: 0;
      right: 0;
      bottom: 0;
      left: 0;
      width: 100%;
      max-width: none;
      height: 100%;
      min-height: 100%;
      margin-left: 0;
      border: 0;
      border-radius: 0; } }
  .reveal.without-overlay {
    position: fixed; }

.switch {
  height: 0.875rem;
  position: relative;
  margin-bottom: 0;
  outline: 0;
  font-size: 0.875rem;
  font-weight: bold;
  color: #fefefe;
  -webkit-user-select: none;
     -moz-user-select: none;
      -ms-user-select: none;
          user-select: none; }

.switch-input {
  position: absolute;
  margin-bottom: 0;
  opacity: 0; }

.switch-paddle {
  position: relative;
  display: block;
  width: 1.75rem;
  height: 0.875rem;
  border-radius: 2px;
  background: #e3e3e3;
  transition: all 0.25s ease-out;
  font-weight: inherit;
  color: inherit;
  cursor: pointer; }
  input + .switch-paddle {
    margin: 0; }
  .switch-paddle::after {
    position: absolute;
    top: 0.25rem;
    left: 0.25rem;
    display: block;
    width: 0.375rem;
    height: 0.375rem;
    transform: translate3d(0, 0, 0);
    border-radius: 50%;
    background: #fefefe;
    transition: all 0.25s ease-out;
    content: ''; }
  input:checked ~ .switch-paddle {
    background: #e75635; }
    input:checked ~ .switch-paddle::after {
      left: 1.125rem; }
  input:disabled ~ .switch-paddle {
    cursor: not-allowed;
    opacity: 0.5; }
  [data-whatinput='mouse'] input:focus ~ .switch-paddle {
    outline: 0; }

.switch-active, .switch-inactive {
  position: absolute;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%); }

.switch-active {
  left: 8%;
  display: none; }
  input:checked + label > .switch-active {
    display: block; }

.switch-inactive {
  right: 15%; }
  input:checked + label > .switch-inactive {
    display: none; }

.switch.tiny {
  height: 1.5rem; }
  .switch.tiny .switch-paddle {
    width: 3rem;
    height: 1.5rem;
    font-size: 0.625rem; }
  .switch.tiny .switch-paddle::after {
    top: 0.25rem;
    left: 0.25rem;
    width: 1rem;
    height: 1rem; }
  .switch.tiny input:checked ~ .switch-paddle::after {
    left: 1.75rem; }

.switch.small {
  height: 1.75rem; }
  .switch.small .switch-paddle {
    width: 3.5rem;
    height: 1.75rem;
    font-size: 0.75rem; }
  .switch.small .switch-paddle::after {
    top: 0.25rem;
    left: 0.25rem;
    width: 1.25rem;
    height: 1.25rem; }
  .switch.small input:checked ~ .switch-paddle::after {
    left: 2rem; }

.switch.large {
  height: 2.5rem; }
  .switch.large .switch-paddle {
    width: 5rem;
    height: 2.5rem;
    font-size: 1rem; }
  .switch.large .switch-paddle::after {
    top: 0.25rem;
    left: 0.25rem;
    width: 2rem;
    height: 2rem; }
  .switch.large input:checked ~ .switch-paddle::after {
    left: 2.75rem; }

table {
  border-collapse: collapse;
  width: 100%;
  margin-bottom: 0;
  border-radius: 2px; }
  thead,
  tbody,
  tfoot {
    border: none;
    background-color: transparent; }
  caption {
    padding: 0.5rem 0.625rem 0.625rem;
    font-weight: bold; }
  thead {
    background: rgba(6, 6, 6, 0);
    color: #333333; }
  tfoot {
    background: rgba(13, 13, 13, 0);
    color: #333333; }
  thead tr,
  tfoot tr {
    background: transparent; }
  thead th,
  thead td,
  tfoot th,
  tfoot td {
    padding: 0.5rem 0.625rem 0.625rem;
    font-weight: bold;
    text-align: left; }
  tbody th,
  tbody td {
    padding: 0.5rem 0.625rem 0.625rem; }
  table.unstriped tbody {
    background-color: transparent; }
    table.unstriped tbody tr {
      border-bottom: 0;
      border-bottom: none;
      background-color: transparent; }

@media print, screen and (max-width: 59.99875em) {
  table.stack thead {
    display: none; }
  table.stack tfoot {
    display: none; }
  table.stack tr,
  table.stack th,
  table.stack td {
    display: block; }
  table.stack td {
    border-top: 0; } }

table.scroll {
  display: block;
  width: 100%;
  overflow-x: auto; }

table.hover thead tr:hover {
  background-color: rgba(1, 1, 1, 0); }

table.hover tfoot tr:hover {
  background-color: rgba(8, 8, 8, 0); }

table.hover tbody tr:hover {
  background-color: rgba(0, 0, 0, 0); }

.table-scroll {
  overflow-x: auto; }

.tabs {
  margin: 0;
  border: 1px solid #e3e3e3;
  background: #fefefe;
  list-style-type: none; }
  .tabs::before, .tabs::after {
    display: table;
    content: ' '; }
  .tabs::after {
    clear: both; }

.tabs.vertical > li {
  display: block;
  float: none;
  width: auto; }

.tabs.simple > li > a {
  padding: 0; }
  .tabs.simple > li > a:hover {
    background: transparent; }

.tabs.primary {
  background: #e75635; }
  .tabs.primary > li > a {
    color: #fefefe; }
    .tabs.primary > li > a:hover, .tabs.primary > li > a:focus {
      background: #e54b28; }

.tabs-title {
  float: left; }
  .tabs-title > a {
    display: block;
    padding: 1.25rem 1.5rem;
    font-size: 0.875rem;
    line-height: 1;
    color: #757575;
    text-decoration: none; }
    [data-whatinput='mouse'] .tabs-title > a {
      outline: 0; }
    .tabs-title > a:hover {
      background: rgba(227, 227, 227, 0.25);
      color: #656565; }
    .tabs-title > a:focus, .tabs-title > a[aria-selected='true'] {
      background: transparent;
      color: #333; }

.tabs-content {
  border: 1px solid #e3e3e3;
  border-top: 0;
  background: #fefefe;
  color: #333333;
  transition: all 0.5s ease; }

.tabs-content.vertical {
  border: 1px solid #e3e3e3;
  border-left: 0; }

.tabs-panel {
  display: none;
  padding: 1rem; }
  .tabs-panel.is-active {
    display: block; }

.title-bar {
  padding: 0.825rem;
  background: #fefefe;
  color: #333; }
  .title-bar::before, .title-bar::after {
    display: table;
    content: ' '; }
  .title-bar::after {
    clear: both; }
  .title-bar .menu-icon {
    margin-left: 0.25rem;
    margin-right: 0.25rem; }

.title-bar-left {
  float: left; }

.title-bar-right {
  float: right;
  text-align: right; }

.title-bar-title {
  display: inline-block;
  vertical-align: middle;
  font-weight: normal; }

.has-tip {
  position: relative;
  display: inline-block;
  border-bottom: dotted 1px #757575;
  font-weight: normal;
  cursor: help; }

.tooltip {
  position: absolute;
  top: calc(100% + 0.6495rem);
  z-index: 1200;
  max-width: 10rem;
  padding: 0.75rem;
  border-radius: 2px;
  background-color: #fefefe;
  font-size: 0.875rem;
  color: #333; }
  .tooltip::before {
    position: absolute; }
  .tooltip.bottom::before {
    display: block;
    width: 0;
    height: 0;
    border: inset 0.75rem;
    content: '';
    border-top-width: 0;
    border-bottom-style: solid;
    border-color: transparent transparent #fefefe;
    bottom: 100%; }
  .tooltip.bottom.align-center::before {
    left: 50%;
    -ms-transform: translateX(-50%);
        transform: translateX(-50%); }
  .tooltip.top::before {
    display: block;
    width: 0;
    height: 0;
    border: inset 0.75rem;
    content: '';
    border-bottom-width: 0;
    border-top-style: solid;
    border-color: #fefefe transparent transparent;
    top: 100%;
    bottom: auto; }
  .tooltip.top.align-center::before {
    left: 50%;
    -ms-transform: translateX(-50%);
        transform: translateX(-50%); }
  .tooltip.left::before {
    display: block;
    width: 0;
    height: 0;
    border: inset 0.75rem;
    content: '';
    border-right-width: 0;
    border-left-style: solid;
    border-color: transparent transparent transparent #fefefe;
    left: 100%; }
  .tooltip.left.align-center::before {
    bottom: auto;
    top: 50%;
    -ms-transform: translateY(-50%);
        transform: translateY(-50%); }
  .tooltip.right::before {
    display: block;
    width: 0;
    height: 0;
    border: inset 0.75rem;
    content: '';
    border-left-width: 0;
    border-right-style: solid;
    border-color: transparent #fefefe transparent transparent;
    right: 100%;
    left: auto; }
  .tooltip.right.align-center::before {
    bottom: auto;
    top: 50%;
    -ms-transform: translateY(-50%);
        transform: translateY(-50%); }
  .tooltip.align-top::before {
    bottom: auto;
    top: 10%; }
  .tooltip.align-bottom::before {
    bottom: 10%;
    top: auto; }
  .tooltip.align-left::before {
    left: 10%;
    right: auto; }
  .tooltip.align-right::before {
    left: auto;
    right: 10%; }

.top-bar {
  padding: 0; }
  .top-bar::before, .top-bar::after {
    display: table;
    content: ' '; }
  .top-bar::after {
    clear: both; }
  .top-bar,
  .top-bar ul {
    background-color: #fefefe; }
  .top-bar input {
    max-width: 200px;
    margin-right: 1rem; }
  .top-bar .input-group-field {
    width: 100%;
    margin-right: 0; }
  .top-bar input.button {
    width: auto; }
  .top-bar .top-bar-left,
  .top-bar .top-bar-right {
    width: 100%; }
  @media print, screen and (min-width: 60em) {
    .top-bar .top-bar-left,
    .top-bar .top-bar-right {
      width: auto; } }
  @media print, screen and (max-width: 59.99875em) {
    .top-bar.stacked-for-medium .top-bar-left,
    .top-bar.stacked-for-medium .top-bar-right {
      width: 100%; } }
  @media print, screen and (max-width: 79.99875em) {
    .top-bar.stacked-for-large .top-bar-left,
    .top-bar.stacked-for-large .top-bar-right {
      width: 100%; } }
  @media print, screen and (max-width: 99.99875em) {
    .top-bar.stacked-for-xlarge .top-bar-left,
    .top-bar.stacked-for-xlarge .top-bar-right {
      width: 100%; } }
  @media print, screen and (max-width: 119.99875em) {
    .top-bar.stacked-for-xxlarge .top-bar-left,
    .top-bar.stacked-for-xxlarge .top-bar-right {
      width: 100%; } }
  .top-bar.stacked-for-xxxlarge .top-bar-left,
  .top-bar.stacked-for-xxxlarge .top-bar-right {
    width: 100%; }

.top-bar-title {
  display: inline-block;
  float: left;
  padding: 0.5rem 1rem 0.5rem 0; }
  .top-bar-title .menu-icon {
    bottom: 2px; }

.top-bar-left {
  float: left; }

.top-bar-right {
  float: right; }

.hide {
  display: none !important; }

.invisible {
  visibility: hidden; }

@media print, screen and (max-width: 39.99875em) {
  .hide-for-small-only {
    display: none !important; } }

@media screen and (max-width: 0em), screen and (min-width: 40em) {
  .show-for-small-only {
    display: none !important; } }

@media print, screen and (min-width: 40em) {
  .hide-for-medium {
    display: none !important; } }

@media screen and (max-width: 39.99875em) {
  .show-for-medium {
    display: none !important; } }

@media print, screen and (min-width: 40em) and (max-width: 59.99875em) {
  .hide-for-medium-only {
    display: none !important; } }

@media screen and (max-width: 39.99875em), screen and (min-width: 60em) {
  .show-for-medium-only {
    display: none !important; } }

@media print, screen and (min-width: 60em) {
  .hide-for-large {
    display: none !important; } }

@media screen and (max-width: 59.99875em) {
  .show-for-large {
    display: none !important; } }

@media print, screen and (min-width: 60em) and (max-width: 79.99875em) {
  .hide-for-large-only {
    display: none !important; } }

@media screen and (max-width: 59.99875em), screen and (min-width: 80em) {
  .show-for-large-only {
    display: none !important; } }

@media screen and (min-width: 80em) {
  .hide-for-xlarge {
    display: none !important; } }

@media screen and (max-width: 79.99875em) {
  .show-for-xlarge {
    display: none !important; } }

@media screen and (min-width: 80em) and (max-width: 99.99875em) {
  .hide-for-xlarge-only {
    display: none !important; } }

@media screen and (max-width: 79.99875em), screen and (min-width: 100em) {
  .show-for-xlarge-only {
    display: none !important; } }

@media screen and (min-width: 100em) {
  .hide-for-xxlarge {
    display: none !important; } }

@media screen and (max-width: 99.99875em) {
  .show-for-xxlarge {
    display: none !important; } }

@media screen and (min-width: 100em) and (max-width: 119.99875em) {
  .hide-for-xxlarge-only {
    display: none !important; } }

@media screen and (max-width: 99.99875em), screen and (min-width: 120em) {
  .show-for-xxlarge-only {
    display: none !important; } }

@media screen and (min-width: 120em) {
  .hide-for-xxxlarge {
    display: none !important; } }

@media screen and (max-width: 119.99875em) {
  .show-for-xxxlarge {
    display: none !important; } }

@media screen and (min-width: 120em) {
  .hide-for-xxxlarge-only {
    display: none !important; } }

@media screen and (max-width: 119.99875em) {
  .show-for-xxxlarge-only {
    display: none !important; } }

.show-for-sr,
.show-on-focus {
  position: absolute !important;
  width: 1px !important;
  height: 1px !important;
  padding: 0 !important;
  overflow: hidden !important;
  clip: rect(0, 0, 0, 0) !important;
  white-space: nowrap !important;
  border: 0 !important; }

.show-on-focus:active, .show-on-focus:focus {
  position: static !important;
  width: auto !important;
  height: auto !important;
  overflow: visible !important;
  clip: auto !important;
  white-space: normal !important; }

.show-for-landscape,
.hide-for-portrait {
  display: block !important; }
  @media screen and (orientation: landscape) {
    .show-for-landscape,
    .hide-for-portrait {
      display: block !important; } }
  @media screen and (orientation: portrait) {
    .show-for-landscape,
    .hide-for-portrait {
      display: none !important; } }

.hide-for-landscape,
.show-for-portrait {
  display: none !important; }
  @media screen and (orientation: landscape) {
    .hide-for-landscape,
    .show-for-portrait {
      display: none !important; } }
  @media screen and (orientation: portrait) {
    .hide-for-landscape,
    .show-for-portrait {
      display: block !important; } }

.float-left {
  float: left !important; }

.float-right {
  float: right !important; }

.float-center {
  display: block;
  margin-right: auto;
  margin-left: auto; }

.clearfix::before, .clearfix::after {
  display: table;
  content: ' '; }

.clearfix::after {
  clear: both; }

.align-left {
  -ms-flex-pack: start;
      justify-content: flex-start; }

.align-right {
  -ms-flex-pack: end;
      justify-content: flex-end; }

.align-center {
  -ms-flex-pack: center;
      justify-content: center; }

.align-justify {
  -ms-flex-pack: justify;
      justify-content: space-between; }

.align-spaced {
  -ms-flex-pack: distribute;
      justify-content: space-around; }

.align-left.vertical.menu > li > a {
  -ms-flex-pack: start;
      justify-content: flex-start; }

.align-right.vertical.menu > li > a {
  -ms-flex-pack: end;
      justify-content: flex-end; }

.align-center.vertical.menu > li > a {
  -ms-flex-pack: center;
      justify-content: center; }

.align-top {
  -ms-flex-align: start;
      align-items: flex-start; }

.align-self-top {
  -ms-flex-item-align: start;
      align-self: flex-start; }

.align-bottom {
  -ms-flex-align: end;
      align-items: flex-end; }

.align-self-bottom {
  -ms-flex-item-align: end;
      align-self: flex-end; }

.align-middle {
  -ms-flex-align: center;
      align-items: center; }

.align-self-middle {
  -ms-flex-item-align: center;
      align-self: center; }

.align-stretch {
  -ms-flex-align: stretch;
      align-items: stretch; }

.align-self-stretch {
  -ms-flex-item-align: stretch;
      align-self: stretch; }

.align-center-middle {
  -ms-flex-pack: center;
      justify-content: center;
  -ms-flex-align: center;
      align-items: center;
  -ms-flex-line-pack: center;
      align-content: center; }

.small-order-1 {
  -ms-flex-order: 1;
      order: 1; }

.small-order-2 {
  -ms-flex-order: 2;
      order: 2; }

.small-order-3 {
  -ms-flex-order: 3;
      order: 3; }

.small-order-4 {
  -ms-flex-order: 4;
      order: 4; }

.small-order-5 {
  -ms-flex-order: 5;
      order: 5; }

.small-order-6 {
  -ms-flex-order: 6;
      order: 6; }

@media print, screen and (min-width: 40em) {
  .medium-order-1 {
    -ms-flex-order: 1;
        order: 1; }
  .medium-order-2 {
    -ms-flex-order: 2;
        order: 2; }
  .medium-order-3 {
    -ms-flex-order: 3;
        order: 3; }
  .medium-order-4 {
    -ms-flex-order: 4;
        order: 4; }
  .medium-order-5 {
    -ms-flex-order: 5;
        order: 5; }
  .medium-order-6 {
    -ms-flex-order: 6;
        order: 6; } }

@media print, screen and (min-width: 60em) {
  .large-order-1 {
    -ms-flex-order: 1;
        order: 1; }
  .large-order-2 {
    -ms-flex-order: 2;
        order: 2; }
  .large-order-3 {
    -ms-flex-order: 3;
        order: 3; }
  .large-order-4 {
    -ms-flex-order: 4;
        order: 4; }
  .large-order-5 {
    -ms-flex-order: 5;
        order: 5; }
  .large-order-6 {
    -ms-flex-order: 6;
        order: 6; } }

@media screen and (min-width: 80em) {
  .xlarge-order-1 {
    -ms-flex-order: 1;
        order: 1; }
  .xlarge-order-2 {
    -ms-flex-order: 2;
        order: 2; }
  .xlarge-order-3 {
    -ms-flex-order: 3;
        order: 3; }
  .xlarge-order-4 {
    -ms-flex-order: 4;
        order: 4; }
  .xlarge-order-5 {
    -ms-flex-order: 5;
        order: 5; }
  .xlarge-order-6 {
    -ms-flex-order: 6;
        order: 6; } }

@media screen and (min-width: 100em) {
  .xxlarge-order-1 {
    -ms-flex-order: 1;
        order: 1; }
  .xxlarge-order-2 {
    -ms-flex-order: 2;
        order: 2; }
  .xxlarge-order-3 {
    -ms-flex-order: 3;
        order: 3; }
  .xxlarge-order-4 {
    -ms-flex-order: 4;
        order: 4; }
  .xxlarge-order-5 {
    -ms-flex-order: 5;
        order: 5; }
  .xxlarge-order-6 {
    -ms-flex-order: 6;
        order: 6; } }

@media screen and (min-width: 120em) {
  .xxxlarge-order-1 {
    -ms-flex-order: 1;
        order: 1; }
  .xxxlarge-order-2 {
    -ms-flex-order: 2;
        order: 2; }
  .xxxlarge-order-3 {
    -ms-flex-order: 3;
        order: 3; }
  .xxxlarge-order-4 {
    -ms-flex-order: 4;
        order: 4; }
  .xxxlarge-order-5 {
    -ms-flex-order: 5;
        order: 5; }
  .xxxlarge-order-6 {
    -ms-flex-order: 6;
        order: 6; } }

.flex-container {
  display: -ms-flexbox;
  display: flex; }

.flex-child-auto {
  -ms-flex: 1 1 auto;
      flex: 1 1 auto; }

.flex-child-grow {
  -ms-flex: 1 0 auto;
      flex: 1 0 auto; }

.flex-child-shrink {
  -ms-flex: 0 1 auto;
      flex: 0 1 auto; }

.flex-dir-row {
  -ms-flex-direction: row;
      flex-direction: row; }

.flex-dir-row-reverse {
  -ms-flex-direction: row-reverse;
      flex-direction: row-reverse; }

.flex-dir-column {
  -ms-flex-direction: column;
      flex-direction: column; }

.flex-dir-column-reverse {
  -ms-flex-direction: column-reverse;
      flex-direction: column-reverse; }

@media print, screen and (min-width: 40em) {
  .medium-flex-container {
    display: -ms-flexbox;
    display: flex; }
  .medium-flex-child-auto {
    -ms-flex: 1 1 auto;
        flex: 1 1 auto; }
  .medium-flex-child-grow {
    -ms-flex: 1 0 auto;
        flex: 1 0 auto; }
  .medium-flex-child-shrink {
    -ms-flex: 0 1 auto;
        flex: 0 1 auto; }
  .medium-flex-dir-row {
    -ms-flex-direction: row;
        flex-direction: row; }
  .medium-flex-dir-row-reverse {
    -ms-flex-direction: row-reverse;
        flex-direction: row-reverse; }
  .medium-flex-dir-column {
    -ms-flex-direction: column;
        flex-direction: column; }
  .medium-flex-dir-column-reverse {
    -ms-flex-direction: column-reverse;
        flex-direction: column-reverse; } }

@media print, screen and (min-width: 60em) {
  .large-flex-container {
    display: -ms-flexbox;
    display: flex; }
  .large-flex-child-auto {
    -ms-flex: 1 1 auto;
        flex: 1 1 auto; }
  .large-flex-child-grow {
    -ms-flex: 1 0 auto;
        flex: 1 0 auto; }
  .large-flex-child-shrink {
    -ms-flex: 0 1 auto;
        flex: 0 1 auto; }
  .large-flex-dir-row {
    -ms-flex-direction: row;
        flex-direction: row; }
  .large-flex-dir-row-reverse {
    -ms-flex-direction: row-reverse;
        flex-direction: row-reverse; }
  .large-flex-dir-column {
    -ms-flex-direction: column;
        flex-direction: column; }
  .large-flex-dir-column-reverse {
    -ms-flex-direction: column-reverse;
        flex-direction: column-reverse; } }

@media screen and (min-width: 80em) {
  .xlarge-flex-container {
    display: -ms-flexbox;
    display: flex; }
  .xlarge-flex-child-auto {
    -ms-flex: 1 1 auto;
        flex: 1 1 auto; }
  .xlarge-flex-child-grow {
    -ms-flex: 1 0 auto;
        flex: 1 0 auto; }
  .xlarge-flex-child-shrink {
    -ms-flex: 0 1 auto;
        flex: 0 1 auto; }
  .xlarge-flex-dir-row {
    -ms-flex-direction: row;
        flex-direction: row; }
  .xlarge-flex-dir-row-reverse {
    -ms-flex-direction: row-reverse;
        flex-direction: row-reverse; }
  .xlarge-flex-dir-column {
    -ms-flex-direction: column;
        flex-direction: column; }
  .xlarge-flex-dir-column-reverse {
    -ms-flex-direction: column-reverse;
        flex-direction: column-reverse; } }

@media screen and (min-width: 100em) {
  .xxlarge-flex-container {
    display: -ms-flexbox;
    display: flex; }
  .xxlarge-flex-child-auto {
    -ms-flex: 1 1 auto;
        flex: 1 1 auto; }
  .xxlarge-flex-child-grow {
    -ms-flex: 1 0 auto;
        flex: 1 0 auto; }
  .xxlarge-flex-child-shrink {
    -ms-flex: 0 1 auto;
        flex: 0 1 auto; }
  .xxlarge-flex-dir-row {
    -ms-flex-direction: row;
        flex-direction: row; }
  .xxlarge-flex-dir-row-reverse {
    -ms-flex-direction: row-reverse;
        flex-direction: row-reverse; }
  .xxlarge-flex-dir-column {
    -ms-flex-direction: column;
        flex-direction: column; }
  .xxlarge-flex-dir-column-reverse {
    -ms-flex-direction: column-reverse;
        flex-direction: column-reverse; } }

@media screen and (min-width: 120em) {
  .xxxlarge-flex-container {
    display: -ms-flexbox;
    display: flex; }
  .xxxlarge-flex-child-auto {
    -ms-flex: 1 1 auto;
        flex: 1 1 auto; }
  .xxxlarge-flex-child-grow {
    -ms-flex: 1 0 auto;
        flex: 1 0 auto; }
  .xxxlarge-flex-child-shrink {
    -ms-flex: 0 1 auto;
        flex: 0 1 auto; }
  .xxxlarge-flex-dir-row {
    -ms-flex-direction: row;
        flex-direction: row; }
  .xxxlarge-flex-dir-row-reverse {
    -ms-flex-direction: row-reverse;
        flex-direction: row-reverse; }
  .xxxlarge-flex-dir-column {
    -ms-flex-direction: column;
        flex-direction: column; }
  .xxxlarge-flex-dir-column-reverse {
    -ms-flex-direction: column-reverse;
        flex-direction: column-reverse; } }

i {
  margin: 0 0.25rem; }
  i.primary {
    color: #e75635; }
  i.secondary {
    color: #50aaeb; }
  i.success {
    color: #66c17b; }
  i.warning {
    color: #ffae00; }
  i.alert {
    color: #cc4b37; }
  i.black {
    color: #333; }
  i.medium-gray {
    color: #aaa; }
  i.dark-gray {
    color: #757575; }
  i.white {
    color: #fefefe; }

.fa.circular {
  border-radius: 100rem;
  color: #fefefe;
  min-height: 1.6em;
  min-width: 1.6em;
  padding: 0.3em;
  text-align: center; }
  .fa.circular.fa-info {
    font-size: 0.7rem;
    min-height: 1.3em;
    min-width: 1.3em;
    padding: 0.15em;
    position: relative;
    top: -0.1rem; }
  .fa.circular.primary {
    background-color: #e75635; }
  .fa.circular.secondary {
    background-color: #50aaeb; }
  .fa.circular.success {
    background-color: #66c17b; }
  .fa.circular.warning {
    background-color: #ffae00; }
  .fa.circular.alert {
    background-color: #cc4b37; }
  .fa.circular.black {
    background-color: #333; }
  .fa.circular.medium-gray {
    background-color: #aaa; }
  .fa.circular.dark-gray {
    background-color: #757575; }
  .fa.circular.white {
    background-color: #fefefe; }

.fa.fa-alert:before {
  content: "\f071"; }

.fa.fa-success:before {
  content: "\f00c"; }

.fa.fa-jpg:before, .fa.fa-png:before {
  content: "\f1c5"; }

.fa.fa-pdf:before {
  content: "\f1c1"; }

.fa.fa-txt:before {
  content: "\f0f6"; }

.material-icons.active::before, .material-icons.confirmed::before {
  color: #66c17b;
  content: "done_all"; }

.material-icons.draft::before, .material-icons.requested::before {
  color: #ffae00;
  content: "info_outline"; }

.material-icons.pending::before, .material-icons.reserved-pending::before, .material-icons.approval-pending::before, .material-icons.preferred::before {
  color: #ffae00;
  content: "chevron_right"; }

.material-icons.pre-proposal::before {
  color: #aaa;
  content: "wb_iridescent"; }

.material-icons.proposal {
  -ms-transform: rotate(180deg);
      transform: rotate(180deg); }
  .material-icons.proposal::before {
    color: #aaa;
    content: "wb_incandescent"; }

.material-icons.reserved::before {
  color: #66c17b;
  content: "done"; }

.material-icons.cancelled::before, .material-icons.deselected::before, .material-icons.rejected::before {
  color: #cc4b37;
  content: "close"; }

.material-icons.new:before, .material-icons.open:before, .material-icons.processing:before, .material-icons.wantmore:before {
  color: #ffae00;
  content: "chevron_right"; }

.material-icons.closed:before, .material-icons.complete:before, .material-icons.presuggest:before {
  color: #66c17b;
  content: "done"; }

.material-icons.successful:before {
  color: #66c17b;
  content: "done_all"; }

.material-icons.failed:before {
  color: #cc4b37;
  content: "close"; }

.material-icons.closable:before, .material-icons.advanced:before {
  color: #ffae00;
  content: "chevron_right"; }

.z-depth-1, .button:not(.clear), .cmp-calendarselect, .cmp-certificateimage, .cmp-checkboxinline, .cmp-eventpackage-iconwrapper, .cmp-numberwidget-buttonwrapper, .cmp-numberwidget-wrapper, .cmp-placerowgroup-item:not(.noshadow), .cmp-requesteditemcustomizeunitsactive-iconwrapper, .cmp-tilehome:not(.noshadow), .cmp-tilerfpitem:not(.noshadow), .autocomplete-suggestions, .pag-eventmodels .pag-eventmodels-scrollable > .cmp-tileeventmodel:not(.noshadow), .pag-hiredetail-similar .cmp-tilelist:not(.noshadow), .pag-homepage-scrollable > .cmp-tileeventmodel:not(.noshadow), .pag-homepage-scrollable > .cmp-tilelist:not(.noshadow), .pag-placedetail-reviewsgrid .cmp-reviewelement:not(.noshadow), .pag-placedetail-similar .cmp-tilelist:not(.noshadow), .pag-recondetail-tileitem:not(.noshadow), .pag-updateinfo-stepnumber {
  box-shadow: 0 1px 2px 0 rgba(0, 0, 0, 0.12), 0 2px 4px 0 rgba(0, 0, 0, 0.08); }

.z-depth-2, .button:not(.clear):active, .dropdown.menu .is-dropdown-submenu, .switch-paddle::after, .slick-slide .card {
  box-shadow: 0 2px 4px 0 rgba(0, 0, 0, 0.12), 0 4px 8px 0 rgba(0, 0, 0, 0.08); }

.z-depth-3, .card, .dropdown-pane, .reveal, .tooltip, .title-bar, .top-bar, .cmp-bars-element, .cmp-navigation.sticky, .cmp-placerowgroup-item:not(.noshadow):hover, .cmp-tilehome:not(.noshadow):hover, .cmp-tilerfpitem:not(.noshadow):hover, .fc-theme-standard .fc-scrollgrid, .slick-slide .card:hover, .pag-eventmodels .pag-eventmodels-scrollable > .cmp-tileeventmodel:not(.noshadow):hover, .pag-hiredetail-similar .cmp-tilelist:not(.noshadow):hover, .pag-homepage-formcard, .pag-homepage-scrollable > .cmp-tileeventmodel:not(.noshadow):hover, .pag-homepage-scrollable > .cmp-tilelist:not(.noshadow):hover, .pag-placedetail-reviewsgrid .cmp-reviewelement:not(.noshadow):hover, .pag-placedetail-similar .cmp-tilelist:not(.noshadow):hover, .pag-placeform .tabs-panel .cmp-placerowelement, .pag-placelist .sb-search-carousel .slick-next, .pag-placelist .sb-search-carousel .slick-prev, .pag-recondetail-tileitem:not(.noshadow):hover {
  box-shadow: 0 4px 8px 0 rgba(0, 0, 0, 0.12), 0 8px 16px 0 rgba(0, 0, 0, 0.08); }

.z-depth-4, .cmp-packageoption.selected, .cmp-tileeventmodel:not(.simplified):hover, .cmp-tilelist:hover, .cmp-tilelist.highlight {
  box-shadow: 0 8px 16px 0 rgba(0, 0, 0, 0.12), 0 16px 24px 0 rgba(0, 0, 0, 0.08); }

.z-depth-5, .pag-homepage-formcard {
  box-shadow: 0 16px 32px 0 rgba(0, 0, 0, 0.12), 0 32px 64px 0 rgba(0, 0, 0, 0.08); }

.font-bold {
  font-weight: bold; }

.font-normal {
  font-weight: normal; }

li.no-bullet {
  list-style: none; }

.text-primary {
  color: #e75635; }

.text-secondary {
  color: #50aaeb; }

.text-success {
  color: #66c17b; }

.text-warning {
  color: #ffae00; }

.text-alert {
  color: #cc4b37; }

.accordion-item {
  margin-bottom: 1rem; }
  .accordion-item.is-active .accordion-title::before {
    content: "\f0d7"; }

.accordion-title {
  background-color: #fefefe; }
  .accordion-title::before {
    font: normal normal normal 14px/1 FontAwesome;
    content: "\f0d9"; }
  .accordion-title:focus {
    background-color: transparent; }
  .accordion-title:hover, .accordion-title:focus {
    color: #333; }

.button {
  position: relative;
  overflow: hidden;
  text-transform: uppercase; }
  .button::after {
    background: rgba(255, 255, 255, 0.25);
    border-radius: 100%;
    content: '';
    height: 5px;
    left: 50%;
    opacity: 0;
    position: absolute;
    top: 50%;
    -ms-transform: scale(1, 1) translate(-50%);
        transform: scale(1, 1) translate(-50%);
    -ms-transform-origin: 50% 50%;
        transform-origin: 50% 50%;
    width: 5px; }

@keyframes ripple {
  0% {
    opacity: 1;
    transform: scale(0, 0); }
  20% {
    opacity: 1;
    transform: scale(25, 25); }
  100% {
    opacity: 0;
    transform: scale(50, 50); } }
  .button:focus:not(:active)::after {
    animation: ripple 1s ease-out; }
  .button.black {
    font-size: 0.875rem; }
  .button.composite {
    border-radius: 50%;
    height: 2rem;
    margin: 0.25rem 0.25rem 0.25rem 0;
    padding: 0.6rem 0;
    text-align: center;
    width: 2rem; }
  .button.circular {
    border-radius: 50%;
    height: 2.5rem;
    padding-right: 0;
    padding-left: 0;
    position: relative;
    width: 2.5rem; }
    .button.circular i {
      left: 0;
      position: absolute;
      right: 0;
      top: 50%;
      -ms-transform: translateY(-50%);
          transform: translateY(-50%); }
  .button.minwidth {
    min-width: 10rem; }
  .button.small {
    padding: 0.765rem 0.85rem 0.7rem !important; }
  .button.tiny {
    padding: 0.5rem 0.65rem; }

.button.medium-gray {
  color: #fefefe; }
  .button.medium-gray:hover, .button.medium-gray:focus {
    color: #fefefe; }

.button.purple {
  color: #fefefe; }
  .button.purple:hover, .button.purple:focus {
    color: #fefefe; }

.button.secondary {
  color: #fefefe; }
  .button.secondary:hover, .button.secondary:focus {
    color: #fefefe; }

[type='button']:not(.button), [type='submit']:not(.button) {
  line-height: inherit;
  color: #333;
  text-decoration: none;
  cursor: pointer; }
  [type='button']:not(.button):hover, [type='button']:not(.button):focus, [type='submit']:not(.button):hover, [type='submit']:not(.button):focus {
    color: rgba(51, 51, 51, 0.75); }

[type='button'].close-button, [type='submit'].close-button {
  color: #aaa; }
  [type='button'].close-button:hover, [type='button'].close-button:focus, [type='submit'].close-button:hover, [type='submit'].close-button:focus {
    color: rgba(170, 170, 170, 0.75); }

a:not(.button).primary, [type="button"]:not(.button).primary, [type='submit']:not(.button).primary {
  color: #e75635; }
  a:not(.button).primary:hover, a:not(.button).primary:focus, [type="button"]:not(.button).primary:hover, [type="button"]:not(.button).primary:focus, [type='submit']:not(.button).primary:hover, [type='submit']:not(.button).primary:focus {
    color: rgba(231, 86, 53, 0.75); }

a:not(.button).secondary, [type="button"]:not(.button).secondary, [type='submit']:not(.button).secondary {
  color: #50aaeb; }
  a:not(.button).secondary:hover, a:not(.button).secondary:focus, [type="button"]:not(.button).secondary:hover, [type="button"]:not(.button).secondary:focus, [type='submit']:not(.button).secondary:hover, [type='submit']:not(.button).secondary:focus {
    color: rgba(80, 170, 235, 0.75); }

a:not(.button).success, [type="button"]:not(.button).success, [type='submit']:not(.button).success {
  color: #66c17b; }
  a:not(.button).success:hover, a:not(.button).success:focus, [type="button"]:not(.button).success:hover, [type="button"]:not(.button).success:focus, [type='submit']:not(.button).success:hover, [type='submit']:not(.button).success:focus {
    color: rgba(102, 193, 123, 0.75); }

a:not(.button).warning, [type="button"]:not(.button).warning, [type='submit']:not(.button).warning {
  color: #ffae00; }
  a:not(.button).warning:hover, a:not(.button).warning:focus, [type="button"]:not(.button).warning:hover, [type="button"]:not(.button).warning:focus, [type='submit']:not(.button).warning:hover, [type='submit']:not(.button).warning:focus {
    color: rgba(255, 174, 0, 0.75); }

a:not(.button).alert, [type="button"]:not(.button).alert, [type='submit']:not(.button).alert {
  color: #cc4b37; }
  a:not(.button).alert:hover, a:not(.button).alert:focus, [type="button"]:not(.button).alert:hover, [type="button"]:not(.button).alert:focus, [type='submit']:not(.button).alert:hover, [type='submit']:not(.button).alert:focus {
    color: rgba(204, 75, 55, 0.75); }

a:not(.button).black, [type="button"]:not(.button).black, [type='submit']:not(.button).black {
  color: #333; }
  a:not(.button).black:hover, a:not(.button).black:focus, [type="button"]:not(.button).black:hover, [type="button"]:not(.button).black:focus, [type='submit']:not(.button).black:hover, [type='submit']:not(.button).black:focus {
    color: rgba(51, 51, 51, 0.75); }

a:not(.button).dark-gray, [type="button"]:not(.button).dark-gray, [type='submit']:not(.button).dark-gray {
  color: #757575; }
  a:not(.button).dark-gray:hover, a:not(.button).dark-gray:focus, [type="button"]:not(.button).dark-gray:hover, [type="button"]:not(.button).dark-gray:focus, [type='submit']:not(.button).dark-gray:hover, [type='submit']:not(.button).dark-gray:focus {
    color: rgba(117, 117, 117, 0.75); }

a:not(.button).medium-gray, [type="button"]:not(.button).medium-gray, [type='submit']:not(.button).medium-gray {
  color: #aaa; }
  a:not(.button).medium-gray:hover, a:not(.button).medium-gray:focus, [type="button"]:not(.button).medium-gray:hover, [type="button"]:not(.button).medium-gray:focus, [type='submit']:not(.button).medium-gray:hover, [type='submit']:not(.button).medium-gray:focus {
    color: rgba(170, 170, 170, 0.75); }

a:not(.button).purple, [type="button"]:not(.button).purple, [type='submit']:not(.button).purple {
  color: #b87af5; }
  a:not(.button).purple:hover, a:not(.button).purple:focus, [type="button"]:not(.button).purple:hover, [type="button"]:not(.button).purple:focus, [type='submit']:not(.button).purple:hover, [type='submit']:not(.button).purple:focus {
    color: rgba(184, 122, 245, 0.75); }

a:not(.button).white, [type="button"]:not(.button).white, [type='submit']:not(.button).white {
  color: #fefefe; }
  a:not(.button).white:hover, a:not(.button).white:focus, [type="button"]:not(.button).white:hover, [type="button"]:not(.button).white:focus, [type='submit']:not(.button).white:hover, [type='submit']:not(.button).white:focus {
    color: rgba(254, 254, 254, 0.75); }

a.underline, [type="button"].underline, [type='submit'].underline {
  text-decoration: underline; }

.card {
  overflow: hidden; }
  .card a:not(.underline) {
    text-decoration: none; }

.card-in-card.card {
  border: #e3e3e3 solid 1px;
  box-shadow: none; }

.dropdown-pane {
  color: #333;
  overflow: hidden;
  transition: opacity .4s ease-in-out, max-height .4s ease-in-out; }
  .dropdown-pane hr {
    margin: 0.5rem 0; }
  .dropdown-pane.fit {
    width: auto; }
  .dropdown-pane .header {
    font-weight: bold; }

.dropdown.menu .is-dropdown-submenu-parent .submenu {
  display: block;
  opacity: 0;
  -ms-transform: scaleY(0);
      transform: scaleY(0);
  -ms-transform-origin: top left;
      transform-origin: top left;
  transition: 0.75s cubic-bezier(0.23, 1, 0.32, 1); }

.dropdown.menu .is-dropdown-submenu-parent:hover .submenu {
  opacity: 1;
  -ms-transform: scaleY(1);
      transform: scaleY(1); }

[type='text'], [type='password'], [type='date'], [type='datetime'], [type='datetime-local'], [type='month'], [type='week'], [type='email'], [type='number'], [type='search'], [type='tel'], [type='time'], [type='url'], [type='color'], textarea, select {
  border-bottom: 1px solid #e3e3e3; }
  [type='text']:focus, [type='password']:focus, [type='date']:focus, [type='datetime']:focus, [type='datetime-local']:focus, [type='month']:focus, [type='week']:focus, [type='email']:focus, [type='number']:focus, [type='search']:focus, [type='tel']:focus, [type='time']:focus, [type='url']:focus, [type='color']:focus, textarea:focus, select:focus {
    border-bottom: 1px solid #333; }

select {
  background-position: 107% center;
  background-position: calc(100% + 0.85rem) center;
  padding-right: 1.4rem !important; }
  select:hover {
    cursor: pointer; }
  select:focus {
    outline: none; }
  select.primary {
    color: #fefefe;
    background-color: #e75635 !important;
    background-image: url('data:image/svg+xml;utf8,<svg xmlns="http://www.w3.org/2000/svg" version="1.1" width="32" height="24" viewBox="0 0 32 24"><polygon points="0,0 32,0 16,24" style="fill: rgb%28255, 255, 255%29"></polygon></svg>');
    background-repeat: no-repeat;
    background-size: 9px 6px;
    border: none; }
    select.primary option {
      background-color: #fefefe !important;
      color: #333; }

input[type=checkbox]:not(.switch-input) {
  opacity: 0;
  position: absolute; }
  input[type=checkbox]:not(.switch-input) + label {
    color: #757575;
    cursor: pointer;
    display: inline-block;
    margin: 0;
    position: relative;
    padding-left: 25px; }
  input[type=checkbox]:not(.switch-input) + label:before {
    border: 1px solid #ccc;
    background-color: #fefefe;
    content: "";
    display: inline-block;
    height: 14px;
    left: 0;
    position: absolute;
    top: 2px;
    width: 14px; }
  input[type=checkbox]:not(.switch-input):checked + label:after {
    color: #555;
    content: '\f00c';
    font-family: FontAwesome;
    font-size: 12px;
    text-align: center;
    line-height: 14px;
    left: 1px;
    position: absolute;
    top: 2px; }
  input[type=checkbox]:not(.switch-input):disabled + label {
    opacity: 0.5; }
  input[type=checkbox]:not(.switch-input):disabled + label:before {
    opacity: 0.5; }
  input[type=checkbox]:not(.switch-input):disabled:checked + label:after {
    opacity: 0.5; }

input[type=radio] {
  opacity: 0;
  position: absolute; }
  input[type=radio] + label {
    color: #333;
    cursor: pointer;
    display: inline-block;
    margin: 0;
    position: relative;
    padding-left: 25px; }
  input[type=radio] + label:before {
    border: 1px solid #ccc;
    background-color: #fefefe;
    border-radius: 100rem;
    content: "";
    display: inline-block;
    height: 14px;
    left: 0;
    position: absolute;
    top: 2px;
    width: 14px; }
  input[type=radio]:checked + label:after {
    color: #555;
    content: "\f111";
    font-family: FontAwesome;
    font-size: 9px;
    text-align: center;
    line-height: 14px;
    left: 3px;
    position: absolute;
    top: 2px; }
  input[type=radio]:disabled + label {
    opacity: 0.5; }
  input[type=radio]:disabled + label:before {
    opacity: 0.5; }
  input[type=radio]:disabled:checked + label:after {
    opacity: 0.5; }

label.circular {
  border-radius: 500rem !important;
  display: inline-block;
  font-size: 0.7rem;
  line-height: 1.35;
  min-width: 1rem;
  min-height: 1rem;
  text-align: center; }
  label.circular.primary {
    color: #fefefe;
    background-color: #e75635; }

label.rectangular {
  border-radius: 2px !important;
  display: inline-block;
  font-size: 0.6rem;
  padding: 0 0.2rem;
  min-height: 0.8rem;
  text-align: center;
  text-transform: uppercase; }
  label.rectangular.primary {
    color: #fefefe;
    background-color: #e75635; }

.row {
  max-width: none;
  margin-left: -0.875rem;
  margin-right: -0.875rem; }
  .row.no-spacing {
    margin-left: 0;
    margin-right: 0; }
    .row.no-spacing .column, .row.no-spacing .columns, .row.no-spacing .columns {
      padding: 0; }
  .row.small-spacing {
    margin-left: -0.25rem;
    margin-right: -0.25rem; }
    .row.small-spacing .column, .row.small-spacing .columns, .row.small-spacing .columns {
      padding: 0.25rem; }
  .row.medium-spacing {
    margin-left: -0.5rem;
    margin-right: -0.5rem; }
    .row.medium-spacing .column, .row.medium-spacing .columns, .row.medium-spacing .columns {
      padding: 0.5rem; }

.column, .columns, .columns {
  padding-bottom: 0.875rem;
  padding-top: 0.875rem; }

.progress {
  border: 1px solid #ccc;
  padding: 0.1rem; }
  .progress p {
    color: #757575;
    font-size: 0.875rem;
    margin-top: 0.125rem;
    text-align: center; }

.reveal.full {
  padding-top: 1rem; }
  @media print, screen and (min-width: 60em) {
    .reveal.full {
      padding-top: 2.5rem; } }

.reveal.with-navigation {
  margin-top: 0.375rem !important;
  top: 3.75rem !important; }
  @media print, screen and (min-width: 60em) {
    .reveal.with-navigation {
      margin-top: 1.5rem !important;
      top: 3.75rem !important; } }

.reveal-back-button {
  padding-left: 0;
  margin-bottom: 1rem; }
  @media print, screen and (min-width: 60em) {
    .reveal-back-button {
      margin-bottom: 2.5rem; } }

.slider {
  height: 0.25rem;
  margin: 0; }

.slider-fill {
  background-color: #50aaeb;
  height: 0.25rem; }

.slider-handle {
  background-color: #fefefe;
  border: 1px solid #aaa;
  border-radius: 50%;
  height: 1.5rem;
  width: 1.5rem; }
  .slider-handle:hover {
    background-color: #e3e3e3; }

.slider-wrapper {
  padding: 0.6rem 0; }

.switch {
  display: inline-block; }

.switch-paddle {
  border-radius: 0.4375rem;
  margin-right: 0.75rem;
  top: 0.1rem;
  transition: all 0.25s ease-out;
  width: 2rem; }
  .switch-paddle::after {
    height: 1.25rem;
    left: -0.3125rem;
    position: absolute;
    top: -0.1875rem;
    width: 1.25rem; }
  input:checked ~ .switch-paddle {
    background: rgba(231, 86, 53, 0.6); }
  input:checked ~ .switch-paddle::after {
    background: #e75635;
    border: none;
    left: 1.1rem; }

.switch-text {
  color: #333;
  display: inline-block;
  font-weight: normal;
  font-size: 1rem;
  margin: 0 0.5rem; }

.tabs {
  border: none;
  border-bottom: 1px solid #ddd; }

.tabs-content {
  border: none; }

.tabs-title-link {
  float: left; }
  .tabs-title-link > a {
    display: block;
    padding: 1.25rem 1.5rem;
    font-size: 0.875rem;
    line-height: 1;
    color: #757575;
    text-decoration: none; }
    [data-whatinput='mouse'] .tabs-title-link > a {
      outline: 0; }
    .tabs-title-link > a:hover {
      background: rgba(227, 227, 227, 0.25);
      color: #656565; }
    .tabs-title-link > a:focus, .tabs-title-link > a[aria-selected='true'] {
      background: transparent;
      color: #333; }

.tabs-title, .tabs-title-link {
  font-weight: bold;
  overflow: hidden;
  text-transform: uppercase; }
  .tabs-title.is-active > a, .tabs-title-link.is-active > a {
    box-shadow: 0 -5px 0 0 #333 inset; }
  .tabs-title.secondary.is-active > a, .tabs-title-link.secondary.is-active > a {
    box-shadow: 0 -5px 0 0 #50aaeb inset; }

.title-bar {
  height: 3.75rem; }
  .title-bar .menu-icon {
    position: absolute;
    right: 0.825rem;
    top: 1.375rem; }

.error input {
  border: 1px solid #cc4b37; }

.error label {
  color: #cc4b37; }

.errorlist {
  color: #cc4b37;
  font-size: 0.875rem;
  margin-left: 0;
  list-style: none; }

.justify-content-center {
  -ms-flex-pack: center;
      justify-content: center; }

.justify-spacebetween {
  -ms-flex-pack: justify;
      justify-content: space-between; }

.justify-flex-end {
  -ms-flex-pack: end;
      justify-content: flex-end; }

.hlp-displayblock {
  display: block; }

.hlp-displayinline {
  display: inline; }

.hlp-displayinlineblock {
  display: inline-block; }

.hlp-overflowhidden {
  overflow: hidden; }

.hlp-hide-empty:empty {
  display: none; }

.hlp-gap-small-only {
  gap: 1rem; }
  @media only screen and (min-width: 960px) {
    .hlp-gap-small-only {
      gap: 0; } }

.hlp-gap {
  gap: 1rem; }

.hlp-gap-small {
  gap: 0.5rem; }

.hlp-hoverable:hover {
  opacity: 80%; }

.hlp-marginbottom-small {
  margin-bottom: 0.25rem; }

.hlp-marginbottom-medium {
  margin-bottom: 0.5rem; }

.hlp-marginbottom {
  margin-bottom: 1rem; }

.hlp-marginbottom-large {
  margin-bottom: 2rem; }

.hlp-marginbottom-xlarge {
  margin-bottom: 4rem; }

.hlp-margintop-small {
  margin-top: 0.25rem; }

.hlp-margintop-medium {
  margin-top: 0.5rem; }

.hlp-marginleft {
  margin-left: 1rem; }

.hlp-marginleft-small {
  margin-left: 0.25rem; }

.hlp-marginright {
  margin-right: 1rem; }

.hlp-margintop {
  margin-top: 1rem; }

.hlp-margintop-large {
  margin-top: 2rem; }

.hlp-margintop-xlarge {
  margin-top: 4rem; }

.hlp-paddingleft {
  padding-left: 1rem; }

.hlp-paddingright {
  padding-right: 1rem; }

.hlp-paddingright-small {
  padding-right: 0.5rem; }

.hlp-position-relative {
  position: relative; }

.hlp-textwrapbalance {
  text-wrap: balance; }

.hlp-textvalueoverridden {
  color: #757575;
  margin-right: 0.25rem;
  text-decoration: line-through; }

.hlp-nomargin {
  margin: 0; }

.hlp-nowrap {
  -ms-flex-wrap: nowrap;
      flex-wrap: nowrap; }

.hlp-pointer {
  cursor: pointer; }
  .hlp-pointer:hover {
    color: #757575; }

.hlp-ellipsis {
  overflow: hidden;
  white-space: nowrap;
  text-overflow: ellipsis; }

.hlp-lightpadded-right {
  padding-right: 0.5rem; }

.hlp-regularfontsize {
  font-size: 1rem; }

.hlp-underline {
  text-decoration: underline; }

.htmx-request .cmp-spinningcircle {
  display: block; }

.link {
  line-height: inherit;
  color: #333;
  text-decoration: underline;
  cursor: pointer; }
  .link:hover, .link:focus {
    color: rgba(51, 51, 51, 0.75); }

.black {
  color: #333; }

.comment {
  color: #757575;
  font-size: 0.875rem; }

.comment-black {
  color: #333;
  font-size: 0.875rem; }

.underline {
  text-decoration: underline; }

.nodecoration {
  text-decoration: none; }

.grayscale {
  filter: grayscale(1); }

.padded {
  padding: 1rem; }

.lyt-container {
  margin-left: auto;
  margin-right: auto;
  padding: 0 0.75rem; }
  @media only screen and (min-width: 640px) {
    .lyt-container {
      padding: 0 1.25rem; } }

.lyt-max-width-640 {
  max-width: 640px; }

.lyt-max-width-960 {
  max-width: 960px; }

.lyt-max-width-1080 {
  max-width: 1080px; }

.lyt-max-width-1200 {
  max-width: 1200px; }

.lyt-max-width-1440 {
  max-width: 1440px; }

.lyt-content.medium-spacing {
  padding-top: 0.75rem; }
  @media only screen and (min-width: 960px) {
    .lyt-content.medium-spacing {
      padding-top: 1.25rem; } }

.lyt-content.large-spacing {
  padding-top: 1.25rem; }
  @media only screen and (min-width: 960px) {
    .lyt-content.large-spacing {
      padding-top: 2.5rem; } }

.lyt-navigation {
  height: 3.75rem; }
  @media only screen and (min-width: 960px) {
    .lyt-navigation.sticky.bottom ~ .lyt-content .cmp-footersection {
      margin-bottom: 5.75rem; } }

.lyt-formstepped-comment {
  margin-bottom: 0.75rem; }

.lyt-formstepped-content {
  padding-left: 0.3rem; }
  @media only screen and (min-width: 640px) {
    .lyt-formstepped-content {
      padding-left: 2rem; } }

.lyt-formstepped-section {
  position: relative; }
  .lyt-formstepped-section:not(:last-child) {
    margin-bottom: 2.5rem; }
    @media only screen and (min-width: 960px) {
      .lyt-formstepped-section:not(:last-child) {
        margin-bottom: 4rem; } }

.lyt-formstepped-title {
  margin-bottom: 0.5rem;
  position: relative; }

.lyt-formstepped-titlenumber {
  background-color: #aaa;
  border-radius: 50%;
  color: #fefefe;
  font-size: 0.875rem;
  height: 1.4rem;
  padding: 0.175rem 0 0.1rem 0;
  text-align: center;
  width: 1.4rem;
  left: 0.2rem;
  position: absolute;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%); }
  .lyt-formstepped-titlenumber::after {
    counter-increment: section;
    content: counter(section); }

.lyt-formstepped-titletext {
  display: inline-block;
  margin-left: 2rem; }

.lyt-formstepped-wrapper {
  counter-reset: section; }

.lyt-reveal .lyt-actions {
  padding: 0 1.5rem 1rem;
  text-align: right; }
  .lyt-reveal .lyt-actions .button {
    margin-left: 1rem; }

.lyt-reveal .lyt-content {
  padding: 0 1.5rem 1rem; }

.lyt-reveal .lyt-header {
  padding: 1rem 1.5rem 0.75rem; }

.lyt-reveal .lyt-image {
  background-clip: content-box;
  background-position: center center;
  background-repeat: no-repeat;
  background-size: cover;
  height: 12rem;
  width: 100%; }

.lyt-reveal.bookingrules {
  overflow-y: visible; }

.lyt-reveal.calendar-cronofy .lyt-actions .row, .lyt-reveal.calendar-feedics .lyt-actions .row, .lyt-reveal.calendar-private .lyt-actions .row, .lyt-reveal.calendar-public .lyt-actions .row {
  margin-left: 0;
  margin-right: 0; }
  .lyt-reveal.calendar-cronofy .lyt-actions .row .column, .lyt-reveal.calendar-cronofy .lyt-actions .row .columns, .lyt-reveal.calendar-feedics .lyt-actions .row .column, .lyt-reveal.calendar-feedics .lyt-actions .row .columns, .lyt-reveal.calendar-private .lyt-actions .row .column, .lyt-reveal.calendar-private .lyt-actions .row .columns, .lyt-reveal.calendar-public .lyt-actions .row .column, .lyt-reveal.calendar-public .lyt-actions .row .columns {
    padding: 0.1rem 0; }

.lyt-reveal.calendar-cronofy .lyt-content, .lyt-reveal.calendar-feedics .lyt-content, .lyt-reveal.calendar-private .lyt-content, .lyt-reveal.calendar-public .lyt-content {
  padding: 1rem 2rem; }
  .lyt-reveal.calendar-cronofy .lyt-content img, .lyt-reveal.calendar-feedics .lyt-content img, .lyt-reveal.calendar-private .lyt-content img, .lyt-reveal.calendar-public .lyt-content img {
    margin-bottom: 0.5rem;
    margin-left: 15%;
    width: 70%; }
  .lyt-reveal.calendar-cronofy .lyt-content .lyt-content-count, .lyt-reveal.calendar-feedics .lyt-content .lyt-content-count, .lyt-reveal.calendar-private .lyt-content .lyt-content-count, .lyt-reveal.calendar-public .lyt-content .lyt-content-count {
    background-color: #bbb;
    border-radius: 50%;
    color: #fefefe;
    font-size: 1.5rem;
    height: 2.4rem;
    line-height: 1.5;
    margin: 0 auto;
    width: 2.4rem; }
  .lyt-reveal.calendar-cronofy .lyt-content .lyt-content-success, .lyt-reveal.calendar-feedics .lyt-content .lyt-content-success, .lyt-reveal.calendar-private .lyt-content .lyt-content-success, .lyt-reveal.calendar-public .lyt-content .lyt-content-success {
    text-align: center; }
    .lyt-reveal.calendar-cronofy .lyt-content .lyt-content-success .fa, .lyt-reveal.calendar-feedics .lyt-content .lyt-content-success .fa, .lyt-reveal.calendar-private .lyt-content .lyt-content-success .fa, .lyt-reveal.calendar-public .lyt-content .lyt-content-success .fa {
      font-size: 6rem;
      margin: 2rem 0; }
    .lyt-reveal.calendar-cronofy .lyt-content .lyt-content-success .lyt-content-success-text, .lyt-reveal.calendar-feedics .lyt-content .lyt-content-success .lyt-content-success-text, .lyt-reveal.calendar-private .lyt-content .lyt-content-success .lyt-content-success-text, .lyt-reveal.calendar-public .lyt-content .lyt-content-success .lyt-content-success-text {
      margin-bottom: 0.5rem; }

.lyt-reveal.cares .lyt-content {
  padding: 0.5rem 2rem 1.5rem; }
  .lyt-reveal.cares .lyt-content .lyt-content-title {
    margin-top: 1rem; }
  .lyt-reveal.cares .lyt-content p {
    margin-top: 0.25rem; }
  .lyt-reveal.cares .lyt-content span {
    margin-right: 1.25rem; }

.lyt-reveal.change-visibility {
  width: 720px; }
  .lyt-reveal.change-visibility .lyt-content {
    padding: 3rem; }
  .lyt-reveal.change-visibility .lyt-content-wrapper + .lyt-content-wrapper {
    border-top: 1px solid #757575;
    margin-top: 1.5rem;
    padding-top: 1.5rem; }

.lyt-reveal.downvoted-edit {
  width: auto; }
  .lyt-reveal.downvoted-edit .lyt-content {
    margin: 0; }

.lyt-reveal.existing-add {
  width: auto; }
  .lyt-reveal.existing-add .lyt-content {
    padding: 0 0.875rem 1rem; }
    .lyt-reveal.existing-add .lyt-content > .row {
      margin: 0; }

.lyt-reveal.highlights-edit input[type="checkbox"] + label {
  margin-top: 2rem; }

.lyt-reveal.highlights-flag p {
  margin-bottom: 1rem; }

.lyt-reveal.highlights-flag select {
  margin-bottom: 1rem; }

.lyt-reveal.hire-errors .lyt-content ul {
  margin: 0.5rem 0 0 1.5rem; }

.lyt-reveal.invite-preview {
  position: relative; }
  .lyt-reveal.invite-preview .lyt-content {
    padding: 2.5rem 2.5rem 0;
    text-align: center; }
    .lyt-reveal.invite-preview .lyt-content .lyt-content-iframe {
      border-style: none;
      height: 31rem;
      max-width: 17rem;
      width: 100%; }
    .lyt-reveal.invite-preview .lyt-content .lyt-content-overlay {
      bottom: 0;
      font-size: 8rem;
      height: 9rem;
      margin: 0;
      left: 0;
      opacity: 0.25;
      position: absolute;
      right: 0;
      top: 50%;
      text-align: center;
      -ms-transform: translateY(-50%) rotate(30deg);
          transform: translateY(-50%) rotate(30deg); }

.lyt-reveal.invoice-address textarea {
  height: 6rem;
  min-height: 6rem; }

.lyt-reveal.local-add {
  width: auto; }
  .lyt-reveal.local-add .lyt-content {
    padding: 0 0.875rem 1rem; }
    .lyt-reveal.local-add .lyt-content > .row {
      margin: 0; }

.lyt-reveal.publish-errors .lyt-content ul {
  margin: 0.5rem 0 0 1.5rem; }
  .lyt-reveal.publish-errors .lyt-content ul li::first-letter {
    text-transform: uppercase; }

.lyt-reveal.recon-suitable {
  width: auto; }

.lyt-reveal.reactivecontent .lyt-content {
  padding: 0 1.5rem 1rem; }
  .lyt-reveal.reactivecontent .lyt-content label:first-child {
    margin-bottom: 1rem; }
  .lyt-reveal.reactivecontent .lyt-content textarea {
    margin-bottom: 1rem; }

.lyt-reveal.renew-plan {
  padding: 2rem;
  width: 24rem; }
  .lyt-reveal.renew-plan .button {
    margin-top: 1rem; }
  .lyt-reveal.renew-plan .lyt-header {
    margin-bottom: 1rem; }

.lyt-reveal.service-edit textarea {
  height: 4.5rem;
  min-height: 4.5rem; }

.lyt-reveal.subhire-edit .cmp-requesteditemfieldset {
  margin: 0.5rem 0; }

.lyt-reveal.subhire-edit .errorlist {
  margin-bottom: 0.5rem; }

.lyt-reveal.subhire-edit .row {
  margin-left: -0.5rem;
  margin-right: -0.5rem; }
  .lyt-reveal.subhire-edit .row .column, .lyt-reveal.subhire-edit .row .columns {
    padding: 0.5rem; }

.lyt-reveal.submissionsteps .lyt-buttons {
  padding-bottom: 2.5rem; }
  @media only screen and (min-width: 640px) {
    .lyt-reveal.submissionsteps .lyt-buttons {
      padding-bottom: 5rem; } }
  @media only screen and (min-width: 960px) {
    .lyt-reveal.submissionsteps .lyt-buttons {
      padding-bottom: 7.5rem; } }

.lyt-reveal.submissionsteps .lyt-text {
  padding-bottom: 1rem; }

.lyt-reveal.submissionsteps .lyt-title {
  padding-bottom: 1rem;
  padding-top: 1rem; }
  @media only screen and (min-width: 640px) {
    .lyt-reveal.submissionsteps .lyt-title {
      padding-top: 2.5rem; } }
  @media only screen and (min-width: 960px) {
    .lyt-reveal.submissionsteps .lyt-title {
      padding-top: 3.75rem; } }

.lyt-reveal.suitability-edit label {
  position: absolute;
  width: 5rem; }

.lyt-reveal.suitability-edit p {
  margin-bottom: 1rem; }

.lyt-reveal.suitability-edit .lyt-content-label {
  color: #e3e3e3;
  font-size: 0.875rem;
  position: absolute;
  text-transform: uppercase;
  text-align: center;
  top: -0.25rem; }
  .lyt-reveal.suitability-edit .lyt-content-label.bad {
    right: calc(65% - 3.9rem);
    width: calc(35% - 2.1rem); }
  .lyt-reveal.suitability-edit .lyt-content-label.good {
    right: calc(25% - 1.2rem);
    width: calc(40% - 2.7rem); }
  .lyt-reveal.suitability-edit .lyt-content-label.super {
    right: 0;
    width: calc(25% - 1.2rem); }

.lyt-reveal.suitability-edit .lyt-content-lines {
  border-left: 1px dashed #e3e3e3;
  border-right: 1px dashed #e3e3e3;
  bottom: -0.25rem;
  position: absolute;
  right: calc(25% - 1.2rem);
  top: 0.5rem;
  width: calc(40% - 2.7rem); }

.lyt-reveal.suitability-edit .lyt-content-wrapper {
  padding-top: 1rem;
  position: relative; }

.lyt-reveal.suitability-edit .slider-wrapper {
  margin-bottom: 0.5rem; }

.lyt-reveal.suitability-edit .slider {
  margin-left: 6rem;
  top: -0.1rem; }

.lyt-reveal.tac-accept form {
  display: inline; }

.lyt-reveal.tac-accept label {
  font-size: 1rem;
  color: #333; }

.lyt-section {
  margin-bottom: 5rem;
  margin-top: 5rem; }
  .lyt-section.small-spacing {
    margin-bottom: 2rem;
    margin-top: 2rem; }
    @media only screen and (min-width: 960px) {
      .lyt-section.small-spacing {
        margin-bottom: 2.5rem; } }
    @media only screen and (min-width: 960px) {
      .lyt-section.small-spacing {
        margin-top: 2.5rem; } }
  .lyt-section.medium-spacing {
    margin-bottom: 2.5rem;
    margin-top: 2.5rem; }
    @media only screen and (min-width: 960px) {
      .lyt-section.medium-spacing {
        margin-bottom: 4rem; } }
    @media only screen and (min-width: 960px) {
      .lyt-section.medium-spacing {
        margin-top: 4rem; } }
  @media only screen and (min-width: 960px) {
    .lyt-section {
      margin-bottom: 10rem; } }
  @media only screen and (min-width: 960px) {
    .lyt-section {
      margin-top: 10rem; } }

@media only screen and (min-width: 640px) {
  .lyt-stepper .lyt-stepper-content {
    border-left: 1px solid #aaa; } }

@media only screen and (min-width: 640px) {
  .lyt-stepper .lyt-stepper-content {
    margin-left: 16px; } }

@media only screen and (min-width: 640px) {
  .lyt-stepper .lyt-stepper-content {
    padding-bottom: 2rem; } }

@media only screen and (min-width: 640px) {
  .lyt-stepper .lyt-stepper-content {
    padding-left: 44px; } }

.lyt-stepper .lyt-stepper-nav {
  position: relative;
  margin: 0.5rem 0 1rem 0; }
  .lyt-stepper .lyt-stepper-nav .lyt-circle {
    background-color: #aaa;
    border-radius: 50%;
    color: #fefefe;
    height: 1.6rem;
    padding: 0.1rem;
    left: 0.2rem;
    position: absolute;
    text-align: center;
    width: 1.6rem; }
  .lyt-stepper .lyt-stepper-nav .lyt-text {
    display: inline-block;
    margin-left: 2.6rem;
    padding-top: 0.25rem; }
  .lyt-stepper .lyt-stepper-nav .lyt-link {
    margin-left: 0.5rem; }
  .lyt-stepper .lyt-stepper-nav.current .lyt-circle {
    font-size: 1.25rem;
    height: 2rem;
    left: 0;
    padding: 0.2rem;
    width: 2rem; }
  .lyt-stepper .lyt-stepper-nav.current .lyt-text {
    margin-left: 3rem;
    padding-top: 0.3rem; }
  .lyt-stepper .lyt-stepper-nav.current .lyt-link {
    margin-left: 0.5rem; }

.cmp-abstractrfp-map {
  height: calc(100vh - 5rem);
  width: 100%; }
  @media only screen and (min-width: 640px) {
    .cmp-abstractrfp-map {
      height: 40rem; } }

.cmp-accountingelement-card {
  border: none;
  border-left: 4px solid transparent;
  margin-bottom: 0.5rem;
  padding: 0.25rem 0.75rem;
  position: relative; }
  @media only screen and (min-width: 640px) {
    .cmp-accountingelement-card {
      padding: 0.75rem 1.25rem; } }
  .cmp-accountingelement-card:hover {
    border-left: 4px solid #e75635; }
  .cmp-accountingelement-card.secondary:hover {
    border-left: 4px solid #50aaeb; }

.cmp-accountingelement-centered {
  position: absolute;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%); }

.cmp-accountingelement-content {
  margin-right: 2.5rem; }
  .cmp-accountingelement-content.disabled {
    opacity: 0.5; }

.cmp-accountingelement-icondownload {
  font-size: 1.25rem;
  position: absolute;
  right: 1.25rem;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%); }

.cmp-accountingelement-id {
  margin-bottom: 0.15rem;
  margin-top: 2rem; }

.cmp-accountingelement-label {
  color: #757575;
  font-size: 0.875rem; }

.cmp-accountingelement-link {
  border-radius: 2rem;
  text-transform: none; }
  .cmp-accountingelement-link.success {
    background-color: rgba(102, 193, 123, 0.1); }
  .cmp-accountingelement-link.warning {
    background-color: rgba(255, 174, 0, 0.1); }

.cmp-assistantsection {
  position: relative; }

@media only screen and (min-width: 640px) {
  .cmp-assistantsection-content {
    margin-left: 5rem; } }

@media only screen and (min-width: 960px) {
  .cmp-assistantsection-content {
    margin-left: 7rem; } }

.cmp-assistantsection-link {
  display: inline-block;
  margin: 0 0.5rem; }

.cmp-assistantsection-phone {
  white-space: nowrap; }

.cmp-assistantsection-photo {
  position: absolute;
  background-color: #fefefe;
  background-position: center;
  background-repeat: no-repeat;
  background-size: cover;
  border-radius: 50%; }
  @media only screen and (min-width: 640px) {
    .cmp-assistantsection-photo {
      height: 4rem; } }
  @media only screen and (min-width: 960px) {
    .cmp-assistantsection-photo {
      height: 6rem; } }
  @media only screen and (min-width: 640px) {
    .cmp-assistantsection-photo {
      width: 4rem; } }
  @media only screen and (min-width: 960px) {
    .cmp-assistantsection-photo {
      width: 6rem; } }

.cmp-assistantsection-text {
  margin-bottom: 0.25rem; }

.cmp-assistantsection-title {
  margin-bottom: 1rem;
  text-align: center; }

.cmp-attachment {
  display: inline-block;
  margin: 0.25rem 0.5rem 0 0;
  padding: 0.25rem; }

.cmp-attachment-form {
  display: inline-block; }

.cmp-attachment-icon {
  font-size: 1rem;
  margin-right: 0.5rem; }

.cmp-attachment-image {
  height: auto;
  width: 100%; }

.cmp-barloading {
  backface-visibility: hidden;
  background-color: transparent;
  height: 0.125rem;
  overflow: hidden;
  position: absolute;
  top: 0;
  width: 100%;
  z-index: 100; }

@keyframes loading {
  from {
    left: -200px;
    width: 30%; }
  50% {
    width: 30%; }
  70% {
    width: 70%; }
  80% {
    left: 50%; }
  95% {
    left: 120%; }
  to {
    left: 100%; } }
  .cmp-barloading:before {
    animation: loading 2s linear infinite;
    background-color: #e75635;
    content: "";
    display: block;
    height: 4px;
    left: -200px;
    position: absolute;
    width: 200px; }

.cmp-barmessages {
  color: #fefefe;
  position: absolute;
  text-align: center;
  top: 0;
  width: 100%;
  z-index: 100; }
  .cmp-barmessages > div {
    background-color: rgba(80, 170, 235, 0.75);
    padding: 0.4rem 0; }
    .cmp-barmessages > div + div {
      border-top: 1px solid #fefefe; }
    .cmp-barmessages > div.error {
      background-color: rgba(204, 75, 55, 0.75); }
      .cmp-barmessages > div.error::before {
        content: "\f071";
        margin-right: 0.4rem;
        font: normal normal normal 14px/1 FontAwesome; }

.cmp-bars.spacedbottom:not(:empty) {
  margin-bottom: 2.5rem; }

.cmp-bars.spacedtop {
  margin-top: 2.5rem; }

.cmp-bars form {
  display: inline-block; }

.cmp-bars .button {
  font-size: 0.875rem;
  margin: 0.125rem 0.25rem;
  padding: 0.765rem 0.85rem 0.7rem 0.85rem !important; }

.cmp-bars-element {
  margin-bottom: 0.5rem;
  padding: 0.5rem 0.75rem;
  position: relative;
  z-index: 100; }
  .cmp-bars-element.provider {
    border-left: 4px solid #50aaeb; }
  .cmp-bars-element.staff {
    border-left: 4px solid #757575; }

.cmp-bars-grid.row {
  margin-bottom: 0.5rem;
  margin-left: -0.3rem;
  margin-right: -0.3rem; }

.cmp-bars-grid .column, .cmp-bars-grid .columns {
  padding: 0.15rem 0.3rem; }

.cmp-bars-title {
  color: #757575;
  font-size: 0.875rem;
  margin-bottom: 0.25rem;
  text-transform: uppercase; }

.cmp-bars-commentedaction {
  margin-bottom: 0.25rem; }
  .cmp-bars-commentedaction span {
    display: inline-block;
    margin-left: 0.25rem; }
  .cmp-bars-commentedaction .button {
    margin-top: 0; }

.cmp-blogpostfullwidth-author {
  margin-top: 0.5rem; }

.cmp-blogpostfullwidth-avatar {
  background-color: #fefefe;
  background-position: center;
  background-repeat: no-repeat;
  background-size: cover;
  border-radius: 50%;
  display: inline-block;
  height: 1.5rem;
  margin-right: 0.25rem;
  position: relative;
  top: -0.1rem;
  width: 1.5rem; }

.cmp-blogpostfullwidth-button {
  margin-top: 0.75rem; }

.cmp-blogpostfullwidth-content {
  padding: 0 0.5rem; }

.cmp-blogpostfullwidth-date {
  margin: 0.25rem 0; }

.cmp-blogpostfullwidth-excerpt {
  padding-right: 0.5rem; }
  .cmp-blogpostfullwidth-excerpt p {
    display: inline; }

.cmp-blogpostfullwidth-title {
  margin-bottom: 0.5rem;
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap; }

.cmp-bookingbrowser {
  text-align: center; }

.cmp-bookingbrowser-arrow {
  background-color: #333;
  color: #fefefe;
  border-radius: 50%;
  height: 1.5rem;
  margin: 0 0.5rem;
  padding: 0.3rem;
  text-align: center;
  width: 1.5rem; }

.cmp-bookingbrowser-link {
  display: block;
  margin: 0.15rem auto; }
  @media only screen and (min-width: 640px) {
    .cmp-bookingbrowser-link {
      display: inline-block; } }
  @media only screen and (min-width: 640px) {
    .cmp-bookingbrowser-link {
      margin: 0; } }

.cmp-bookingbrowser-text {
  display: block;
  margin: 0.15rem auto; }
  @media only screen and (min-width: 640px) {
    .cmp-bookingbrowser-text {
      display: inline-block; } }
  @media only screen and (min-width: 640px) {
    .cmp-bookingbrowser-text {
      margin: 0 1rem; } }

.cmp-bookingexport {
  font-size: 0.875rem; }

.cmp-bookingexport-intro {
  margin-right: 0.5rem; }

.cmp-bookingexport-link {
  margin-right: 0.5rem; }

.cmp-bookingfrequency-tile {
  transition: 0.2s; }
  .cmp-bookingfrequency-tile:hover {
    background-color: #f1f8fd; }
  .cmp-bookingfrequency-tile label {
    width: 100%;
    border: 1px solid #e3e3e3;
    border-right: 0; }
  .cmp-bookingfrequency-tile:nth-last-child(3) label {
    border: 1px solid #e3e3e3; }
  .cmp-bookingfrequency-tile input[type=radio] + label {
    padding: 0.5rem 0;
    padding-left: 0.5rem; }
    .cmp-bookingfrequency-tile input[type=radio] + label:before, .cmp-bookingfrequency-tile input[type=radio] + label:after {
      visibility: hidden; }
  .cmp-bookingfrequency-tile input[type=radio]:checked + label {
    border: 1px solid #50aaeb; }

.cmp-bookingfrequency-indicatorswrapper {
  -ms-flex-pack: justify;
      justify-content: space-between;
  font-size: 0.875rem;
  color: #aaa;
  margin-top: 0.25rem;
  margin-bottom: 0.5rem; }

.cmp-bookingplaceinfo-icon {
  position: relative;
  top: 0.1rem; }
  .cmp-bookingplaceinfo-icon.material-icons {
    font-size: 0.875rem; }

.cmp-bookingplaceinfo-placeicon {
  color: #757575; }

.cmp-bookingplaceinfo-anchor {
  font-size: 0.875rem; }

.cmp-bookingplaceinfo-infocontainer {
  gap: 0.5rem;
  -ms-flex-align: start;
      align-items: flex-start; }

.cmp-bookingplaceinfo-staricon {
  margin: 0 0.1rem; }

.cmp-bookingplaceinfo-uspcontainer {
  margin-top: 1rem; }

.cmp-bookingplaceinfo-valuelabel {
  color: #757575; }

.cmp-bookingplaceinfo-wrapper {
  margin-top: 1rem;
  gap: 0.5rem; }

.cmp-bookingpayout-list {
  margin-bottom: 1rem;
  margin-top: 0.25rem; }

.cmp-bookingpayout-text {
  margin-bottom: 1rem; }

.cmp-bookingrecap-button {
  margin-top: 0.25rem; }

.cmp-bookingrecap-element {
  margin-bottom: 1rem; }

.cmp-bookingrecap-icon {
  color: #757575;
  margin: 0 0 0.125rem; }

.cmp-bookingrecap-label {
  margin-bottom: 0.25rem; }

.cmp-bookingrecap-spacer {
  padding-right: 0.25rem; }

.cmp-bookingrecap-status {
  position: relative;
  top: -0.5rem; }

.cmp-bookingrecap-title {
  margin-bottom: 0.5rem;
  text-transform: uppercase; }

.cmp-bookingrecapshort {
  text-align: center; }

.cmp-bookingrecapshort-arrow {
  color: #aaa;
  display: inline-block;
  font-size: 1.25rem;
  margin: 0.5rem;
  position: relative;
  top: -0.25rem; }

.cmp-bookingrecapshort-content {
  margin-left: 2.5rem;
  margin-right: 2.5rem; }

.cmp-bookingrecapshort-date {
  margin-top: 1rem; }

.cmp-bookingrecapshort-detail {
  margin: 0.5rem 1.25rem;
  position: relative; }
  @media only screen and (min-width: 640px) {
    .cmp-bookingrecapshort-detail {
      display: inline-block; } }
  @media only screen and (min-width: 640px) {
    .cmp-bookingrecapshort-detail {
      text-align: left; } }

.cmp-bookingrecapshort-icon {
  color: #757575;
  font-size: 1.25rem;
  left: 0.75rem;
  position: absolute;
  top: 0.35rem; }

.cmp-calendarinline-arrow {
  position: relative; }

.cmp-calendarinline-cell {
  height: 1.2rem;
  padding: 0 0.2rem; }

.cmp-calendarinline-cells {
  height: 1.2rem; }
  .cmp-calendarinline-cells.row {
    margin: 0; }

.cmp-calendarinline-day {
  padding: 0 0.2rem; }

.cmp-calendarinline-days.row {
  margin: 0; }

.cmp-calendarinline-heading:first-child .cmp-calendarinline-cell {
  margin: 0; }

.cmp-calendarinline-heading > .row {
  margin: 0; }
  .cmp-calendarinline-heading > .row > .column, .cmp-calendarinline-heading > .row > .columns {
    padding: 0; }

.cmp-calendarinline-hour {
  position: relative;
  top: -0.05rem; }

.cmp-calendarinline-inner {
  height: 100%; }

.cmp-calendarinline-line.row {
  margin: 0; }

.cmp-calendarinline-line > .column, .cmp-calendarinline-line > .columns {
  padding: 0;
  position: relative; }

.cmp-calendarinline-navigation {
  padding-bottom: 0.75rem;
  padding-top: 0.75rem;
  text-align: center; }
  .cmp-calendarinline-navigation + .cmp-calendarinline-navigation {
    padding-top: 0; }
  .cmp-calendarinline-navigation > .row {
    margin: 0; }
    .cmp-calendarinline-navigation > .row > .column, .cmp-calendarinline-navigation > .row > .columns {
      padding: 0; }

.cmp-calendarinline-title {
  display: inline-block; }

.cmp-calendarinline-actions {
  padding: 0.5rem;
  position: relative;
  text-align: center; }
  .cmp-calendarinline-actions .row {
    margin: 0; }
    .cmp-calendarinline-actions .row .column, .cmp-calendarinline-actions .row .columns {
      padding: 0;
      position: relative; }

.cmp-calendarinline-arrow {
  color: #757575; }
  .cmp-calendarinline-arrow i {
    font-size: 1.25rem;
    padding: 0 0.25rem; }

.cmp-calendarinline-cell {
  border-bottom: 1px solid #ddd;
  border-left: none;
  border-right: 1px solid #ddd;
  border-top: none;
  background-color: #fefefe; }
  .cmp-calendarinline-cell.closed {
    background-color: #eee; }
  .cmp-calendarinline-cell.unavailable {
    background-color: #ccc; }
  .cmp-calendarinline-cell.unrestricted {
    background-color: #f0f0f0;
    background-image: repeating-linear-gradient(30deg, #f0f0f0, #f0f0f0 10px, #fefefe 10px, #fefefe 20px); }
  .cmp-calendarinline-cell.past {
    background-color: #eee; }
  .cmp-calendarinline-cell.selected:not(.closed) {
    background-color: rgba(231, 86, 53, 0.6);
    background-image: none; }
  .cmp-calendarinline-cell.potential:not(.closed):not(.selected) {
    background-color: #fbe4df;
    background-image: none; }
  .cmp-calendarinline-cell.checkin {
    border-top: 2px solid #e75635 !important;
    border-left: 2px solid #e75635 !important; }
  .cmp-calendarinline-cell.checkout {
    border-bottom: 2px solid #e75635 !important;
    border-right: 2px solid #e75635 !important; }
  .cmp-calendarinline-cell.potential-checkin:not(.checkin) {
    border-top: 2px solid rgba(231, 86, 53, 0.6) !important;
    border-left: 2px solid rgba(231, 86, 53, 0.6) !important; }
  .cmp-calendarinline-cell.potential-checkout:not(.checkout) {
    border-bottom: 2px solid rgba(231, 86, 53, 0.6) !important;
    border-right: 2px solid rgba(231, 86, 53, 0.6) !important; }

.cmp-calendarinline-day .small {
  color: #aaa;
  font-size: 0.875rem; }

.cmp-calendarinline-heading {
  padding-bottom: 0.75rem; }

.cmp-calendarinline-hour {
  color: #aaa;
  font-size: 0.875rem;
  padding: 0 0.5rem;
  text-align: right; }

.cmp-calendarinline-line:first-child .cmp-calendarinline-cell {
  border-top: 1px solid #ddd; }

.cmp-calendarinline-line:nth-child(odd) .cmp-calendarinline-cell {
  border-bottom: 1px dotted #ddd; }

.cmp-calendarinline-line:last-child > .column .cmp-calendarinline-cell, .cmp-calendarinline-line:last-child > .columns .cmp-calendarinline-cell {
  border-bottom: 1px solid #ddd; }
  .cmp-calendarinline-line:last-child > .column .cmp-calendarinline-cell.closed, .cmp-calendarinline-line:last-child > .columns .cmp-calendarinline-cell.closed {
    border-bottom: 1px solid #eee; }
  .cmp-calendarinline-line:last-child > .column .cmp-calendarinline-cell.unavailable, .cmp-calendarinline-line:last-child > .columns .cmp-calendarinline-cell.unavailable {
    border-bottom: 1px solid #ccc; }
  .cmp-calendarinline-line:last-child > .column .cmp-calendarinline-cell.past, .cmp-calendarinline-line:last-child > .columns .cmp-calendarinline-cell.past {
    border-bottom: 1px solid #eee; }

.cmp-calendarinline-line > .column:last-child .cmp-calendarinline-cell, .cmp-calendarinline-line > .columns:last-child .cmp-calendarinline-cell {
  border-right: 1px solid #ddd; }
  .cmp-calendarinline-line > .column:last-child .cmp-calendarinline-cell:first-child, .cmp-calendarinline-line > .columns:last-child .cmp-calendarinline-cell:first-child {
    border-left: 1px solid #ddd; }
  .cmp-calendarinline-line > .column:last-child .cmp-calendarinline-cell:last-child, .cmp-calendarinline-line > .columns:last-child .cmp-calendarinline-cell:last-child {
    border-right: 1px solid #ddd; }

.cmp-calendarinline-link {
  color: #aaa;
  display: inline-block;
  padding: 0.5rem 0;
  text-decoration: underline; }
  @media only screen and (min-width: 960px) {
    .cmp-calendarinline-link {
      padding: 0.25rem 0; } }

.cmp-calendarinline-title {
  font-size: 1.125rem;
  padding: 0 0.75rem; }

.cmp-calendarinline-weeks {
  padding-top: 0.5rem; }
  .cmp-calendarinline-weeks .button {
    color: #333;
    font-size: 0.75rem;
    margin: 0.25rem;
    padding: 0.5rem 0.75rem;
    text-transform: none; }
    .cmp-calendarinline-weeks .button.active {
      background-color: #e3e3e3; }

.cmp-calendarinline-hour {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap; }

.cmp-calendarinline-inner {
  font-size: 0.65rem; }

.cmp-calendarmonthly {
  height: 100%;
  margin: 0 auto;
  position: relative;
  z-index: 800; }
  @media only screen and (min-width: 960px) {
    .cmp-calendarmonthly {
      height: 38.5rem; } }
  @media only screen and (min-width: 960px) {
    .cmp-calendarmonthly {
      margin: 2.5rem auto; } }
  @media only screen and (min-width: 960px) {
    .cmp-calendarmonthly {
      max-width: 25rem; } }

.cmp-calendarmonthly-action {
  background-color: #fefefe;
  bottom: 5.5rem;
  box-shadow: 0 2px 1px 0 rgba(0, 0, 0, 0.08) inset;
  height: 8.5rem;
  left: 0;
  padding: 1rem;
  position: fixed;
  right: 0; }
  @media only screen and (min-width: 960px) {
    .cmp-calendarmonthly-action {
      bottom: auto; } }
  @media only screen and (min-width: 960px) {
    .cmp-calendarmonthly-action {
      left: auto; } }
  @media only screen and (min-width: 960px) {
    .cmp-calendarmonthly-action {
      position: relative; } }
  @media only screen and (min-width: 960px) {
    .cmp-calendarmonthly-action {
      right: auto; } }

.cmp-calendarmonthly-close {
  right: 1rem;
  position: absolute;
  top: 0.5rem; }
  .cmp-calendarmonthly-close i {
    font-size: 1.5rem;
    margin: 0; }

.cmp-calendarmonthly-confirm {
  background-color: #f7f7f7;
  bottom: 0;
  box-shadow: 0 2px 1px 0 rgba(0, 0, 0, 0.08) inset;
  height: 5.5rem;
  left: 0;
  padding: 1rem;
  position: fixed;
  right: 0; }
  @media only screen and (min-width: 960px) {
    .cmp-calendarmonthly-confirm {
      position: absolute; } }

.cmp-calendarmonthly-confirmbutton {
  line-height: 1.1;
  padding: 0.85rem 1rem 0.8rem;
  width: 100%; }
  .cmp-calendarmonthly-confirmbutton.disabled {
    line-height: 1;
    padding: 1.35rem 1rem 1.3rem; }

.cmp-calendarmonthly-daynumber {
  cursor: pointer;
  display: inline-block;
  height: 2rem;
  padding-top: 0.475rem;
  width: 2rem; }
  .cmp-calendarmonthly-daynumber.disabled {
    color: #e3e3e3;
    cursor: not-allowed; }
  .cmp-calendarmonthly-daynumber.selected {
    background-color: #50aaeb;
    border-radius: 50%;
    color: white; }

.cmp-calendarmonthly-intro {
  background-color: #fefefe;
  box-shadow: 0 2px 1px 0 rgba(0, 0, 0, 0.08);
  height: 4rem;
  left: 0;
  position: fixed;
  right: 0;
  top: 0; }
  @media only screen and (min-width: 960px) {
    .cmp-calendarmonthly-intro {
      left: auto; } }
  @media only screen and (min-width: 960px) {
    .cmp-calendarmonthly-intro {
      position: relative; } }
  @media only screen and (min-width: 960px) {
    .cmp-calendarmonthly-intro {
      right: auto; } }
  @media only screen and (min-width: 960px) {
    .cmp-calendarmonthly-intro {
      top: auto; } }

.cmp-calendarmonthly-inputgrid.row {
  height: 100%;
  margin-left: 0;
  margin-right: 0;
  padding-left: 0.125rem;
  padding-right: 0.125rem;
  padding-top: 5rem; }
  @media only screen and (min-width: 960px) {
    .cmp-calendarmonthly-inputgrid.row {
      padding-top: 1rem; } }

.cmp-calendarmonthly-monthname {
  padding-bottom: 0.5rem; }

.cmp-calendarmonthly-monthwrapper {
  padding: 2rem 1rem; }

.cmp-calendarmonthly-navigatemonth {
  display: block;
  padding: 1rem;
  text-decoration: underline; }

.cmp-calendarmonthly-scrollable {
  background-color: #fefefe;
  overflow-y: scroll;
  padding: 4rem 0 15.5rem; }
  @media only screen and (min-width: 960px) {
    .cmp-calendarmonthly-scrollable {
      height: calc(100% - 18rem); } }
  @media only screen and (min-width: 960px) {
    .cmp-calendarmonthly-scrollable {
      padding: 0; } }

.cmp-calendarmonthly-slotbutton {
  background-color: #e3e3e3;
  border-radius: 2px;
  display: block;
  padding: 0.25rem;
  text-align: center;
  width: 100%; }
  .cmp-calendarmonthly-slotbutton.disabled.disabled {
    pointer-events: none;
    opacity: 0.25; }
  .cmp-calendarmonthly-slotbutton.padded {
    padding-bottom: 0.75rem;
    padding-top: 0.75rem; }
  .cmp-calendarmonthly-slotbutton.selected {
    background-color: #50aaeb;
    color: white; }

.cmp-calendarmonthly-slotgrid.row {
  margin-left: -0.25rem;
  margin-right: -0.25rem; }

.cmp-calendarmonthly-slotgrid > .column, .cmp-calendarmonthly-slotgrid > .columns {
  padding: 0.25rem; }

.cmp-calendarmonthly-slotlink {
  display: block;
  padding: 0.25rem;
  text-align: center;
  text-decoration: underline;
  width: 100%; }

.cmp-calendarmonthly-slottext {
  display: block;
  font-size: 0.875rem; }

.cmp-calendarmonthly-weekdays {
  bottom: 0.5rem;
  color: #aaa;
  left: 1rem;
  position: absolute;
  right: 2rem;
  text-align: center; }

.cmp-calendarmonthly-weekdaysgrid.row {
  margin-left: -0.1rem;
  margin-right: -0.1rem; }

.cmp-calendarmonthly-weekdaysgrid > .column, .cmp-calendarmonthly-weekdaysgrid > .columns {
  padding: 0.1rem; }

.cmp-calendarmonthly-weekgrid {
  margin-left: -0.5rem;
  margin-right: -0.5rem;
  text-align: center; }
  .cmp-calendarmonthly-weekgrid > .column, .cmp-calendarmonthly-weekgrid > .columns {
    padding: 0 0.5rem; }

.cmp-calendarselect {
  width: 10rem; }
  @media only screen and (min-width: 640px) {
    .cmp-calendarselect {
      left: 0; } }
  @media only screen and (min-width: 640px) {
    .cmp-calendarselect {
      position: absolute; } }
  @media only screen and (min-width: 640px) {
    .cmp-calendarselect {
      top: 0.75rem; } }

.cmp-calendarwidget-arrow {
  position: relative; }

.cmp-calendarwidget-cell {
  height: 2rem;
  padding: 0 0.2rem; }

.cmp-calendarwidget-cells {
  height: 2rem; }
  .cmp-calendarwidget-cells.row {
    margin: 0; }

.cmp-calendarwidget-day {
  padding: 0 0.2rem; }

.cmp-calendarwidget-days.row {
  margin: 0; }

.cmp-calendarwidget-heading:first-child .cmp-calendarwidget-cell {
  margin: 0; }

.cmp-calendarwidget-heading > .row {
  margin: 0; }
  .cmp-calendarwidget-heading > .row > .column, .cmp-calendarwidget-heading > .row > .columns {
    padding: 0; }

.cmp-calendarwidget-hour {
  position: relative;
  top: -0.05rem; }

.cmp-calendarwidget-inner {
  height: 100%; }

.cmp-calendarwidget-line.row {
  margin: 0; }

.cmp-calendarwidget-line > .column, .cmp-calendarwidget-line > .columns {
  padding: 0;
  position: relative; }

.cmp-calendarwidget-navigation {
  padding-bottom: 0.75rem;
  padding-top: 0.75rem;
  text-align: center; }
  .cmp-calendarwidget-navigation + .cmp-calendarwidget-navigation {
    padding-top: 0; }
  .cmp-calendarwidget-navigation > .row {
    margin: 0; }
    .cmp-calendarwidget-navigation > .row > .column, .cmp-calendarwidget-navigation > .row > .columns {
      padding: 0; }

.cmp-calendarwidget-title {
  display: inline-block; }

.cmp-calendarwidget-actions {
  padding: 0.5rem;
  position: relative;
  text-align: center; }
  .cmp-calendarwidget-actions .row {
    margin: 0; }
    .cmp-calendarwidget-actions .row .column, .cmp-calendarwidget-actions .row .columns {
      padding: 0;
      position: relative; }

.cmp-calendarwidget-arrow {
  color: #757575; }
  .cmp-calendarwidget-arrow i {
    font-size: 1.25rem;
    padding: 0 0.25rem; }

.cmp-calendarwidget-cell {
  border-bottom: 1px solid #ddd;
  border-left: none;
  border-right: 1px solid #ddd;
  border-top: none;
  background-color: #fefefe; }
  .cmp-calendarwidget-cell.closed {
    background-color: #eee; }
  .cmp-calendarwidget-cell.unavailable {
    background-color: #ccc; }
  .cmp-calendarwidget-cell.unrestricted {
    background-color: #f0f0f0;
    background-image: repeating-linear-gradient(30deg, #f0f0f0, #f0f0f0 10px, #fefefe 10px, #fefefe 20px); }
  .cmp-calendarwidget-cell.past {
    background-color: #eee; }
  .cmp-calendarwidget-cell.selected:not(.closed) {
    background-color: rgba(231, 86, 53, 0.6);
    background-image: none; }
  .cmp-calendarwidget-cell.potential:not(.closed):not(.selected) {
    background-color: #fbe4df;
    background-image: none; }
  .cmp-calendarwidget-cell.checkin {
    border-top: 2px solid #e75635 !important;
    border-left: 2px solid #e75635 !important; }
  .cmp-calendarwidget-cell.checkout {
    border-bottom: 2px solid #e75635 !important;
    border-right: 2px solid #e75635 !important; }
  .cmp-calendarwidget-cell.potential-checkin:not(.checkin) {
    border-top: 2px solid rgba(231, 86, 53, 0.6) !important;
    border-left: 2px solid rgba(231, 86, 53, 0.6) !important; }
  .cmp-calendarwidget-cell.potential-checkout:not(.checkout) {
    border-bottom: 2px solid rgba(231, 86, 53, 0.6) !important;
    border-right: 2px solid rgba(231, 86, 53, 0.6) !important; }

.cmp-calendarwidget-day .small {
  color: #aaa;
  font-size: 0.875rem; }

.cmp-calendarwidget-heading {
  padding-bottom: 0.75rem; }

.cmp-calendarwidget-hour {
  color: #aaa;
  font-size: 0.875rem;
  padding: 0 0.5rem;
  text-align: right; }

.cmp-calendarwidget-line:first-child .cmp-calendarwidget-cell {
  border-top: 1px solid #ddd; }

.cmp-calendarwidget-line:nth-child(odd) .cmp-calendarwidget-cell {
  border-bottom: 1px dotted #ddd; }

.cmp-calendarwidget-line:last-child > .column .cmp-calendarwidget-cell, .cmp-calendarwidget-line:last-child > .columns .cmp-calendarwidget-cell {
  border-bottom: 1px solid #ddd; }
  .cmp-calendarwidget-line:last-child > .column .cmp-calendarwidget-cell.closed, .cmp-calendarwidget-line:last-child > .columns .cmp-calendarwidget-cell.closed {
    border-bottom: 1px solid #eee; }
  .cmp-calendarwidget-line:last-child > .column .cmp-calendarwidget-cell.unavailable, .cmp-calendarwidget-line:last-child > .columns .cmp-calendarwidget-cell.unavailable {
    border-bottom: 1px solid #ccc; }
  .cmp-calendarwidget-line:last-child > .column .cmp-calendarwidget-cell.past, .cmp-calendarwidget-line:last-child > .columns .cmp-calendarwidget-cell.past {
    border-bottom: 1px solid #eee; }

.cmp-calendarwidget-line > .column:last-child .cmp-calendarwidget-cell, .cmp-calendarwidget-line > .columns:last-child .cmp-calendarwidget-cell {
  border-right: 1px solid #ddd; }
  .cmp-calendarwidget-line > .column:last-child .cmp-calendarwidget-cell:first-child, .cmp-calendarwidget-line > .columns:last-child .cmp-calendarwidget-cell:first-child {
    border-left: 1px solid #ddd; }
  .cmp-calendarwidget-line > .column:last-child .cmp-calendarwidget-cell:last-child, .cmp-calendarwidget-line > .columns:last-child .cmp-calendarwidget-cell:last-child {
    border-right: 1px solid #ddd; }

.cmp-calendarwidget-link {
  color: #aaa;
  display: inline-block;
  padding: 0.5rem 0;
  text-decoration: underline; }
  @media only screen and (min-width: 960px) {
    .cmp-calendarwidget-link {
      padding: 0.25rem 0; } }

.cmp-calendarwidget-title {
  font-size: 1.125rem;
  padding: 0 0.75rem; }

.cmp-calendarwidget-weeks {
  padding-top: 0.5rem; }
  .cmp-calendarwidget-weeks .button {
    color: #333;
    font-size: 0.75rem;
    margin: 0.25rem;
    padding: 0.5rem 0.75rem;
    text-transform: none; }
    .cmp-calendarwidget-weeks .button.active {
      background-color: #e3e3e3; }

.cmp-calendarwidget {
  margin: 0 auto;
  min-width: 320px;
  z-index: 800; }
  @media only screen and (min-width: 960px) {
    .cmp-calendarwidget {
      margin: 0.5rem 10rem 0; } }
  @media only screen and (min-width: 1280px) {
    .cmp-calendarwidget {
      margin: 0.5rem auto 0; } }
  @media only screen and (min-width: 1600px) {
    .cmp-calendarwidget {
      margin: 5rem auto 0; } }
  @media only screen and (min-width: 1280px) {
    .cmp-calendarwidget {
      max-width: 60rem; } }

@media only screen and (min-width: 1600px) {
  .cmp-calendarwidget-actions {
    padding: 0.75rem; } }

.cmp-calendarwidget-buttons .button {
  margin: 0; }

.cmp-calendarwidget-buttonfloating {
  bottom: 1rem;
  position: fixed;
  right: 1rem;
  border-radius: 1.5rem;
  height: 3rem;
  text-align: center;
  font-size: 1.25rem;
  padding: 0.85rem 0;
  width: 3rem; }

.cmp-calendarwidget-card {
  z-index: 100; }

@media only screen and (min-width: 640px) {
  .cmp-calendarwidget-cell {
    height: 1.5rem; } }

@media only screen and (min-width: 640px) {
  .cmp-calendarwidget-cells {
    height: 1.5rem; } }

.cmp-calendarwidget-day .small {
  display: block; }
  @media only screen and (min-width: 640px) {
    .cmp-calendarwidget-day .small {
      display: inline; } }

.cmp-calendarwidget-heading {
  padding-top: 0.5rem; }

.cmp-calendarwidget-hour {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%); }

.cmp-calendarwidget-inner {
  font-size: 0.875rem; }

.cmp-calendarwidget-lines {
  background-color: #fefefe;
  padding-bottom: 2.5rem;
  padding-top: 1rem; }
  @media only screen and (min-width: 640px) {
    .cmp-calendarwidget-lines {
      padding-bottom: 0; } }
  @media only screen and (min-width: 640px) {
    .cmp-calendarwidget-lines {
      padding-top: 0; } }

.cmp-calendarwidget-link {
  padding: 0.5rem 0; }
  @media only screen and (min-width: 960px) {
    .cmp-calendarwidget-link {
      padding: 0.65rem 0; } }

.cmp-calendarwidget-tabselement {
  border-bottom: 1px solid #e3e3e3;
  height: 2.8125rem;
  line-height: 1.4;
  padding: 0.825rem;
  position: relative;
  width: 100%; }
  @media only screen and (min-width: 640px) {
    .cmp-calendarwidget-tabselement {
      margin-right: 1rem; } }

@media only screen and (min-width: 640px) {
  .cmp-calendarwidget-tabsgrid {
    display: inline-block; } }

@media only screen and (min-width: 640px) {
  .cmp-calendarwidget-tabsgrid {
    vertical-align: middle; } }

@media only screen and (min-width: 640px) {
  .cmp-calendarwidget-tabsgrid {
    width: 24rem; } }

.cmp-calendarwidget-tabsgrid.row {
  margin: 0;
  padding: 0.25rem; }

.cmp-calendarwidget-tabsgrid .column, .cmp-calendarwidget-tabsgrid .columns {
  padding: 0 0.25rem; }

.cmp-calendarwidget-tabshelp {
  color: #757575;
  padding: 0.5rem 0.75rem;
  text-align: center; }
  @media only screen and (min-width: 640px) {
    .cmp-calendarwidget-tabshelp {
      display: inline-block; } }
  @media only screen and (min-width: 640px) {
    .cmp-calendarwidget-tabshelp {
      vertical-align: middle; } }

.cmp-calendarwidget-tabsicon {
  font-size: 1.25rem;
  margin: 0.2rem;
  position: absolute;
  right: 0.75rem;
  top: 0.65rem; }
  .cmp-calendarwidget-tabsicon:not(.success):not(.alert) {
    color: #333;
    opacity: 0.5; }

.cmp-calendarwidget-tabstext {
  font-size: 0.875rem; }
  .cmp-calendarwidget-tabstext.medium-gray {
    color: #aaa; }

.cmp-calendarwidget-year {
  color: #aaa;
  font-size: 0.875rem; }
  @media only screen and (min-width: 640px) {
    .cmp-calendarwidget-year {
      color: #333; } }
  @media only screen and (min-width: 640px) {
    .cmp-calendarwidget-year {
      font-size: 1rem; } }

.cmp-certificateimage {
  margin-top: 1.5rem;
  max-width: 12rem;
  width: 100%; }

.cmp-checkboxinline {
  display: inline-block;
  margin: 0.15rem;
  padding: 0.15rem 0.75rem 0.25rem;
  box-shadow: none; }

.cmp-checkbox-multiplewrapper {
  margin-top: 0.5rem; }

.cmp-chip {
  border: 1px solid #e3e3e3;
  border-radius: 1rem;
  display: inline-block;
  font-size: 0.875rem;
  padding: 0.2rem 0.5rem;
  text-decoration: none; }
  .cmp-chip:hover {
    background-color: #e3e3e3; }
  .cmp-chip.hollow {
    background-color: transparent;
    border: 1px solid #ddd; }
  .cmp-chip.interactable {
    cursor: pointer; }

.cmp-chip-unselectable {
  border: 1px solid #e3e3e3;
  border-radius: 1rem;
  display: inline-block;
  font-size: 0.875rem;
  padding: 0.2rem 0.5rem;
  text-decoration: none;
  background-color: transparent;
  border: #333 solid 1px; }
  .cmp-chip-unselectable:hover {
    background-color: #e3e3e3; }
  .cmp-chip-unselectable.hollow {
    background-color: transparent;
    border: 1px solid #ddd; }
  .cmp-chip-unselectable.interactable {
    cursor: pointer; }
  .cmp-chip-unselectable:hover {
    background-color: #f0f0f0 !important; }

.cmp-chip-selectable.cmp-chip {
  background-color: transparent; }
  .cmp-chip-selectable.cmp-chip:hover {
    background-color: #f0f0f0 !important; }

.cmp-chip-selectable:has(.cmp-chip-selectablecheckbox:checked) {
  border: #333 solid 1px; }

.cmp-chip-selectable:not(:has(.cmp-chip-selectablecheckbox:checked)) {
  border: 1px solid #e3e3e3; }

.cmp-chip-selectablecheckbox[type=checkbox]:not(.switch-input) {
  opacity: 0;
  position: absolute; }
  .cmp-chip-selectablecheckbox[type=checkbox]:not(.switch-input):checked + .cmp-chip-selectablelabel {
    color: #333; }
  .cmp-chip-selectablecheckbox[type=checkbox]:not(.switch-input) + label {
    color: #aaa;
    cursor: pointer;
    display: inline-block;
    margin: 0;
    position: relative;
    padding-left: 0px; }
  .cmp-chip-selectablecheckbox[type=checkbox]:not(.switch-input) + label:before {
    display: none; }
  .cmp-chip-selectablecheckbox[type=checkbox]:not(.switch-input):checked + label:after {
    content: ''; }

.cmp-chip-selectablecontainer {
  display: -ms-flexbox;
  display: flex;
  -ms-flex-wrap: wrap;
      flex-wrap: wrap;
  row-gap: 0.5rem;
  column-gap: 0.2rem; }

.cmp-contactuser-comment {
  margin-left: 3.75rem;
  padding-top: 0.125rem; }
  .cmp-contactuser-comment i {
    margin: 0;
    -ms-transform: scale(0.8, 0.8);
        transform: scale(0.8, 0.8); }

.cmp-contactuser-icon, .cmp-contactuser-picture {
  font-size: 1.25rem;
  height: 2.75rem;
  padding: 0.5rem 0;
  position: absolute;
  width: 2.75rem; }

.cmp-contactuser-icon {
  border-radius: 50%;
  color: #fefefe;
  margin: 0 auto;
  text-align: center; }
  .cmp-contactuser-icon:empty:after {
    content: "\f007";
    font-family: "FontAwesome"; }

.cmp-contactuser-name {
  margin-left: 3.75rem; }

.cmp-contactuser-picture {
  background-color: #fefefe;
  background-position: center;
  background-repeat: no-repeat;
  background-size: cover;
  border-radius: 50%; }

.cmp-conversation-actioncomment {
  margin-top: 0.5rem; }

.cmp-conversation-actiongrid.row {
  margin-left: -0.5rem;
  margin-right: -0.5rem; }

.cmp-conversation-actiongrid .column, .cmp-conversation-actiongrid .columns {
  padding: 0.5rem; }

.cmp-conversation-actionlegaltext {
  color: #757575;
  font-size: 0.875rem;
  margin-top: 0.5rem;
  text-align: left; }
  .cmp-conversation-actionlegaltext a {
    font-size: 0.875rem; }

.cmp-conversation-actionmessage textarea {
  height: 4rem;
  min-height: 4rem;
  width: 100%; }

.cmp-conversation-actionsend {
  clear: both;
  margin-top: 0.75rem;
  min-height: 2.4rem;
  position: relative; }
  .cmp-conversation-actionsend p {
    margin-right: 8.75rem; }
  .cmp-conversation-actionsend .button {
    min-width: 7rem; }

.cmp-conversation-attachmentlabel {
  margin-top: 1.25rem; }

.cmp-conversation-event {
  font-size: 0.875rem;
  margin-bottom: 0.75rem;
  text-align: center; }

.cmp-conversation-form {
  padding: 1rem; }

.cmp-conversation-intro {
  padding-bottom: 1.5rem; }

.cmp-conversation-messageauthor span.booker, .cmp-conversation-messageauthor span.provider, .cmp-conversation-messageauthor span.staff {
  border-radius: 2px;
  color: #fefefe;
  display: inline-block;
  font-size: 0.875rem;
  font-weight: normal;
  margin-left: 0.25rem;
  padding: 0.15rem 0.5rem;
  position: relative;
  top: -0.05rem; }
  .cmp-conversation-messageauthor span.booker:first-letter, .cmp-conversation-messageauthor span.provider:first-letter, .cmp-conversation-messageauthor span.staff:first-letter {
    text-transform: uppercase; }

.cmp-conversation-messageauthor span.booker {
  background-color: #e75635; }

.cmp-conversation-messageauthor span.provider {
  background-color: #50aaeb; }

.cmp-conversation-messageauthor span.staff {
  background-color: #757575; }

.cmp-conversation-messagebody p {
  text-align: justify;
  word-wrap: break-word; }

.cmp-conversation-messagedate {
  color: #757575;
  font-size: 0.875rem;
  text-align: right; }

.cmp-conversation-messageicon, .cmp-conversation-messagepicture {
  height: 2rem;
  padding: 0.25rem 0;
  position: absolute;
  top: 0.3rem;
  width: 2rem; }

.cmp-conversation-messageicon {
  border-radius: 50%;
  color: #fefefe;
  margin: 0 auto;
  text-align: center; }
  .cmp-conversation-messageicon:empty:after {
    content: "\f007";
    font-family: "FontAwesome"; }

.cmp-conversation-messagepicture {
  background-color: #fefefe;
  background-position: center;
  background-repeat: no-repeat;
  background-size: cover;
  border-radius: 50%; }

.cmp-conversation-messagetexts {
  background-color: #f7f7f7;
  margin-bottom: 0.75rem;
  margin-left: 3rem;
  margin-right: 4rem;
  padding: 0.45rem 0.875rem;
  position: relative; }
  .cmp-conversation-messagetexts:after {
    border-color: transparent #f7f7f7;
    border-style: solid;
    border-width: 10px 10px 10px 0;
    bottom: auto;
    content: "";
    display: block;
    left: -10px;
    position: absolute;
    top: 10px;
    width: 0; }
  .cmp-conversation-messagetexts.full {
    margin-right: 0.875rem; }
  .cmp-conversation-messagetexts.shifted {
    margin-left: 5rem;
    margin-right: 0.875rem; }
    .cmp-conversation-messagetexts.shifted:after {
      border-width: 10px 0 10px 10px;
      left: auto;
      right: -10px; }

.cmp-conversation-messagewrapper {
  position: relative; }

.cmp-conversation-posts {
  margin-bottom: 0.45rem; }

.cmp-conversation-subtitle {
  margin-bottom: 0.45rem;
  margin-top: 0; }

.cmp-conversation-view {
  margin-bottom: 0.875rem;
  text-align: right; }
  .cmp-conversation-view .button {
    margin: 0;
    min-width: 7rem;
    padding: 0.65rem !important; }

.cmp-customers {
  padding: 2.5rem 1rem;
  text-align: center; }

.cmp-customers-grid.row {
  max-width: 1440px;
  margin: 0 auto; }

.cmp-customers-grid .column, .cmp-customers-grid .columns {
  padding-bottom: 0;
  padding-top: 0; }

.cmp-customers-image {
  max-width: 6rem; }
  @media only screen and (min-width: 960px) {
    .cmp-customers-image {
      max-width: 100%; } }

.cmp-customers-intro {
  color: #aaa;
  margin: 0 auto;
  max-width: 840px; }

.cmp-dashboardstage-tile {
  border-right: 5px solid transparent;
  color: #aaa;
  overflow: hidden;
  position: relative; }
  @media only screen and (min-width: 640px) {
    .cmp-dashboardstage-tile {
      border-right: none; } }
  @media only screen and (min-width: 640px) {
    .cmp-dashboardstage-tile {
      border-top: 5px solid transparent; } }
  .cmp-dashboardstage-tile:not(:last-child) {
    border-bottom: 1px solid #e3e3e3; }
    @media only screen and (min-width: 640px) {
      .cmp-dashboardstage-tile:not(:last-child) {
        border-right: 1px solid #e3e3e3; } }
  .cmp-dashboardstage-tile.active {
    cursor: pointer;
    color: #333; }
    .cmp-dashboardstage-tile.active:hover {
      color: #757575; }
  .cmp-dashboardstage-tile input[type=radio] + label {
    color: inherit;
    padding: 0.75rem 0;
    padding-left: 0.75rem; }
    .cmp-dashboardstage-tile input[type=radio] + label:before, .cmp-dashboardstage-tile input[type=radio] + label:after {
      visibility: hidden; }
  .cmp-dashboardstage-tile input[type=radio]:checked + label {
    border-left: 5px solid #333; }
    @media only screen and (min-width: 640px) {
      .cmp-dashboardstage-tile input[type=radio]:checked + label {
        border-bottom: 5px solid #333; } }
    @media only screen and (min-width: 640px) {
      .cmp-dashboardstage-tile input[type=radio]:checked + label {
        border-left: none; } }

.cmp-dashboardstage-wrapper {
  margin-bottom: 2rem; }
  .cmp-dashboardstage-wrapper .row {
    margin-left: 0;
    margin-right: 0; }

.cmp-dashboard-actions {
  margin: 1rem auto; }
  @media only screen and (min-width: 640px) {
    .cmp-dashboard-actions {
      margin: 2rem auto; } }

.cmp-dashboard-title {
  margin-bottom: 2.75rem; }

.cmp-dashboardrow-herospace {
  bottom: 0;
  height: 1.25rem;
  position: absolute;
  right: 0; }

.cmp-dashboardrow-icon {
  font-size: 1.25rem;
  height: 2.4rem;
  padding: 0.3rem 0;
  position: absolute;
  width: 2.4rem; }
  .cmp-dashboardrow-icon.single {
    border-radius: 50%;
    color: #fefefe;
    margin: 0 auto;
    text-align: center; }
    .cmp-dashboardrow-icon.single:empty:after {
      content: "\f007";
      font-family: "FontAwesome"; }
  .cmp-dashboardrow-icon.multiple {
    border-radius: 50%;
    color: #fefefe;
    margin: 0 auto;
    padding: 0.6rem 0 0;
    text-align: center; }
  .cmp-dashboardrow-icon ~ .cmp-dashboardrow-text {
    margin-left: 3rem; }

.cmp-dashboardrow-image {
  background-color: #fefefe;
  background-position: center;
  background-repeat: no-repeat;
  background-size: cover;
  border-radius: 50%;
  background-clip: content-box;
  height: 2.4rem;
  position: absolute;
  width: 2.4rem; }
  .cmp-dashboardrow-image ~ .cmp-dashboardrow-text {
    margin-left: 3rem; }

.cmp-dashboardrow-postcircle {
  background-color: #e75635;
  border-radius: 50%;
  color: #fefefe;
  font-size: 0.875rem;
  height: 1.25rem;
  line-height: 1.45;
  position: absolute;
  text-align: center;
  top: 4rem;
  width: 1.25rem; }
  @media only screen and (min-width: 640px) {
    .cmp-dashboardrow-postcircle {
      top: 1rem; } }

.cmp-dashboardrow-postcontent {
  margin-left: 2rem; }

.cmp-dashboardrow-text {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap;
  font-size: 0.875rem; }
  .cmp-dashboardrow-text.gray {
    color: #757575; }
  .cmp-dashboardrow-text i {
    font-size: 1.25rem;
    margin-right: 0.2rem;
    position: relative;
    top: 0.05rem; }
  .cmp-dashboardrow-text + .cmp-dashboardrow-text {
    margin-top: 0.1rem; }

.cmp-emailtip {
  margin-top: 0.5rem;
  padding: 0.5rem 0.75rem;
  position: relative; }

.cmp-emailtip-content {
  margin-left: 3rem; }

.cmp-emailtip-icon {
  font-size: 1.75rem;
  top: 0.875rem;
  position: absolute; }

.cmp-enquiryanswerservices-columnheaderwrapper {
  margin: 1rem 0; }
  .cmp-enquiryanswerservices-columnheaderwrapper .cmp-enquiryanswerservices-columnheader {
    color: #757575;
    font-size: 0.875rem;
    text-align: start; }

.cmp-enquiryanswerservices-descriptionanchor {
  cursor: pointer; }

.cmp-enquiryanswerservices-description {
  font-size: 0.875rem;
  color: #757575;
  overflow: hidden;
  text-overflow: ellipsis;
  display: block;
  white-space: nowrap; }

.cmp-enquiryanswerservices-descriptionwrapper {
  padding-right: 1.25rem; }

.cmp-enquiryanswerservices-descriptionwrapperinner {
  -ms-flex-wrap: nowrap;
      flex-wrap: nowrap; }

.cmp-enquiryanswerservices-errtext {
  font-size: 0.875rem;
  color: #cc4b37; }

.cmp-enquiryanswerservices-extrasname {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap;
  display: block; }

.cmp-enquiryanswerservices-helptext {
  color: #757575;
  font-size: 0.875rem; }

.cmp-enquiryanswerservices-formwrapper {
  margin-top: 2rem;
  margin-bottom: 1rem;
  counter-reset: section; }

.cmp-enquiryanswerservices-pricevaluewrapper {
  margin-top: 0.5rem;
  margin-bottom: 1.5rem;
  -ms-flex-align: center;
      align-items: center; }

.cmp-enquiryanswerservices-sectiontitlewrapper {
  margin-top: 1.25rem;
  margin-bottom: 0.5rem; }

.cmp-enquiryanswerservices-spacepriceicon {
  font-size: 2.5rem;
  margin-top: 0.25rem;
  margin-right: 0.5rem;
  color: #aaa; }

.cmp-enquiryanswerservices-sectionnumber {
  background-color: #aaa;
  border-radius: 50%;
  color: #fefefe;
  font-size: 0.875rem;
  height: 1.4rem;
  padding: 0.175rem 0 0.1rem 0;
  text-align: center;
  width: 1.4rem;
  display: block; }
  .cmp-enquiryanswerservices-sectionnumber::after {
    counter-increment: section;
    content: counter(section); }

.cmp-enquiryanswerservices-servicestoggle {
  margin-right: 0.75rem;
  gap: 0.5rem; }

.cmp-enquiryanswerservices-servicestoggleinfoicon {
  font-size: 1.2rem;
  color: #757575; }

.cmp-enquiryanswerservices-servicestogglewrapperinner {
  margin-bottom: 1rem;
  -ms-flex-wrap: nowrap;
      flex-wrap: nowrap;
  gap: 0.5rem; }
  .cmp-enquiryanswerservices-servicestogglewrapperinner .cmp-enquiryanswerservices-servicestoggledesctext {
    text-align: left;
    margin-top: 0.25rem; }
  .cmp-enquiryanswerservices-servicestogglewrapperinner .cmp-enquiryanswerservices-servicestoggletext {
    text-align: left; }

.cmp-enquiryanswerservices-spacestogglewrapper {
  margin-top: 2rem; }

.cmp-enquiryanswerservices-servicestogglewrapper {
  -ms-flex-wrap: nowrap;
      flex-wrap: nowrap; }

.cmp-enquiryanswerservices-serviceswrapper {
  -ms-flex-align: center;
      align-items: center; }

.cmp-enquiryanswerservices-spacesfieldwrapper {
  margin-bottom: 2.25rem; }

.cmp-extrasupselling-container {
  background-color: rgba(231, 86, 53, 0.1);
  position: relative;
  padding: 0.5rem 0.75rem;
  margin: 1.5rem 0; }
  @media only screen and (min-width: 960px) {
    .cmp-extrasupselling-container {
      padding: 1rem 1.5rem; } }

.cmp-extrasupselling-icon {
  background-size: 100%;
  height: 1.5rem;
  width: 1.5rem;
  display: block; }

.cmp-extrasupselling-servicescontainer {
  gap: 0.5rem; }
  @media only screen and (min-width: 640px) {
    .cmp-extrasupselling-servicescontainer {
      gap: 1rem; } }

.cmp-extrasupselling-price {
  font-size: 0.875rem;
  color: #757575; }

.cmp-extrasupselling-text {
  margin-bottom: 1rem; }

.cmp-extrasupselling-title {
  margin-bottom: 0.25rem; }

.cmp-fieldtogglable {
  margin-bottom: 0.75rem;
  position: relative; }

.cmp-fieldtogglable-area {
  display: none;
  margin: 0; }

input[type=checkbox].cmp-fieldtogglable-checkbox {
  border: 0;
  clip: rect(0 0 0 0);
  height: 1px;
  width: 1px;
  margin: -1px;
  overflow: hidden;
  padding: 0;
  position: absolute; }
  input[type=checkbox].cmp-fieldtogglable-checkbox:checked ~ .cmp-fieldtogglable-area {
    display: block;
    padding-bottom: 0.225rem; }
  input[type=checkbox].cmp-fieldtogglable-checkbox + .cmp-fieldtogglable-label {
    text-decoration: underline;
    color: #757575;
    display: block;
    padding-left: 0; }
    input[type=checkbox].cmp-fieldtogglable-checkbox + .cmp-fieldtogglable-label:hover {
      color: #aaa; }
    input[type=checkbox].cmp-fieldtogglable-checkbox + .cmp-fieldtogglable-label::before {
      display: none; }
    input[type=checkbox].cmp-fieldtogglable-checkbox + .cmp-fieldtogglable-label i {
      font-size: 1.2rem;
      position: relative;
      top: 0.3rem; }
  input[type=checkbox].cmp-fieldtogglable-checkbox:checked + .cmp-fieldtogglable-label {
    display: none; }

.cmp-flowsteps {
  counter-increment: step;
  position: relative; }

.cmp-flowsteps-check {
  border: 1px solid #757575;
  border-radius: 50%;
  box-sizing: content-box;
  color: #757575;
  font-size: 1.25rem;
  height: 1.75rem;
  position: relative;
  text-align: center;
  width: 1.75rem;
  background-color: #aaa;
  border-color: #aaa;
  color: #aaa; }
  .cmp-flowsteps-check::after {
    content: "done";
    font-family: 'Material Icons';
    left: 0;
    position: absolute;
    right: 0;
    top: 50%;
    -ms-transform: translateY(-50%);
        transform: translateY(-50%); }
  .cmp-flowsteps-check::after {
    color: white; }

.cmp-flowsteps-dot {
  background-color: #cc4b37;
  border-radius: 50%;
  height: 1rem;
  left: 1.25rem;
  position: absolute;
  top: 1.25rem;
  width: 1rem; }

.cmp-flowsteps-icon {
  font-size: 5rem; }

.cmp-flowsteps-line {
  background-image: linear-gradient(to right, #aaa 60%, transparent 0%);
  background-position: bottom;
  background-repeat: repeat-x;
  background-size: 14.4% 3px;
  height: 1rem;
  margin-left: 2.6rem;
  position: absolute;
  width: calc(100% - 2.5rem); }

.cmp-flowsteps-number {
  border: 1px solid #757575;
  border-radius: 50%;
  box-sizing: content-box;
  color: #757575;
  font-size: 1.25rem;
  height: 1.75rem;
  position: relative;
  text-align: center;
  width: 1.75rem;
  background-color: #aaa;
  border-color: #aaa;
  color: #aaa; }
  .cmp-flowsteps-number::after {
    color: white; }
  .cmp-flowsteps-number::after {
    content: counter(step); }

.cmp-flowsteps-publish {
  border-radius: 50%;
  background-color: #cc4b37;
  height: 1.75rem;
  opacity: 0.5;
  width: 1.75rem; }

.cmp-flowsteps-title {
  margin: 0.25rem 0 0.5rem; }
  @media only screen and (min-width: 960px) {
    .cmp-flowsteps-title {
      margin: 1.5rem 0 0.75rem; } }

.cmp-eventpackage {
  position: relative; }

.cmp-eventpackage-comment {
  color: #757575;
  font-size: 0.875rem; }

.cmp-eventpackage-content {
  margin-left: 2.5rem; }
  .cmp-eventpackage-content.padded {
    margin-left: 5rem; }

.cmp-eventpackage-icon {
  background-size: 100%;
  height: 1.75rem;
  position: absolute;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%);
  width: 1.75rem; }

.cmp-eventpackage-image {
  background-size: 100%;
  height: 3.5rem;
  position: absolute;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%);
  width: 4.75rem; }

.cmp-eventpackage-title {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap; }
  .cmp-eventpackage-title::first-letter {
    text-transform: uppercase; }

.cmp-eventpackage-actionstatusiconswrapper i {
  cursor: pointer;
  margin-right: 0;
  margin-left: 0.2rem; }

.cmp-eventpackage-actionstatusiconswrapper .cmp-eventpackage-actionstatusspacing {
  display: none;
  margin: 0 0.25rem; }
  @media only screen and (min-width: 640px) {
    .cmp-eventpackage-actionstatusiconswrapper .cmp-eventpackage-actionstatusspacing {
      display: inline-block; } }

.cmp-eventpackage-addbtn {
  padding: 0;
  overflow: visible;
  width: 2.25rem;
  height: 2.25rem; }

.cmp-eventpackage-addwrapper {
  -ms-flex-pack: center;
      justify-content: center;
  -ms-flex-align: center;
      align-items: center; }

.cmp-eventpackage-iconwrapper {
  height: 100%;
  width: 100%;
  border-radius: 50%;
  border: 1px solid #e3e3e3;
  -ms-flex-pack: center;
      justify-content: center;
  -ms-flex-align: center;
      align-items: center; }

.cmp-eventpackage-commentwrapper {
  padding-right: 0.5rem;
  -ms-flex-wrap: nowrap;
      flex-wrap: nowrap;
  -ms-flex-align: center;
      align-items: center; }
  @media only screen and (min-width: 640px) {
    .cmp-eventpackage-commentwrapper {
      padding-right: 1.5rem; } }

.cmp-eventpackage-detail {
  padding-bottom: 0.5rem;
  padding-top: 0.5rem; }

.cmp-eventpackage-section {
  position: relative; }
  .cmp-eventpackage-section:not(:last-child) {
    margin-bottom: 2.5rem; }
    @media only screen and (min-width: 960px) {
      .cmp-eventpackage-section:not(:last-child) {
        margin-bottom: 4rem; } }

.cmp-eventpackage-sectiontitle {
  margin-bottom: 0.5rem;
  position: relative; }

.cmp-eventpackage-sectioncontent {
  padding-left: 0.3rem; }
  @media only screen and (min-width: 640px) {
    .cmp-eventpackage-sectioncontent {
      padding-left: 2rem; } }

.cmp-eventpackage-sectiontitletext {
  display: inline-block;
  margin-left: 2rem; }

.cmp-eventpackage-shortdescription {
  font-size: 0.875rem; }
  .cmp-eventpackage-shortdescription.trimmed {
    overflow: hidden;
    text-overflow: ellipsis;
    display: block;
    white-space: nowrap; }

.cmp-eventpackage-title {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap; }

.cmp-eventpackage-titlewrapper {
  display: -ms-flexbox;
  display: flex;
  -ms-flex-direction: column;
      flex-direction: column; }
  @media only screen and (min-width: 640px) {
    .cmp-eventpackage-titlewrapper {
      -ms-flex-direction: row;
          flex-direction: row; } }

.cmp-eventpackage-textcta {
  margin-bottom: 0.25rem; }

.cmp-fileinputs {
  border-radius: 2px;
  border: 3px dashed #ccc;
  cursor: pointer;
  min-height: 6.25rem;
  padding: 1rem 1.5rem;
  text-align: center; }
  .cmp-fileinputs a {
    display: block;
    margin-top: 0.25rem; }
  @media only screen and (min-width: 640px) {
    .cmp-fileinputs input[name*="description"] {
      display: inline-block; } }
  @media only screen and (min-width: 640px) {
    .cmp-fileinputs input[name*="description"] {
      width: calc(100% - 14rem); } }
  .cmp-fileinputs input:not([name*="description"]) {
    display: block;
    height: 0;
    opacity: 0;
    width: 0; }
    @media only screen and (min-width: 640px) {
      .cmp-fileinputs input:not([name*="description"]) {
        display: inline-block; } }
  .cmp-fileinputs label[for*="description"] {
    display: none; }
  .cmp-fileinputs label:not([for*="description"]) {
    border: none;
    margin-left: 2rem;
    padding: 0.825rem;
    position: relative;
    top: 0.25rem; }
    @media only screen and (min-width: 640px) {
      .cmp-fileinputs label:not([for*="description"]) {
        display: inline-block; } }
    @media only screen and (min-width: 640px) {
      .cmp-fileinputs label:not([for*="description"]) {
        width: 9rem; } }
    .cmp-fileinputs label:not([for*="description"]):hover {
      cursor: pointer; }
    .cmp-fileinputs label:not([for*="description"]):before {
      content: '\f0c6';
      font-family: FontAwesome;
      font-size: 1.25rem;
      left: -1rem;
      position: absolute;
      text-align: center;
      top: 0.6rem; }
    .cmp-fileinputs label:not([for*="description"]) span {
      overflow: hidden;
      text-overflow: ellipsis;
      white-space: nowrap;
      display: block; }

.cmp-fileinputs-icon.material-icons {
  font-size: 3rem; }

.cmp-finalizehelp {
  background-color: #e3e3e3;
  padding: 0.5rem 0.5rem 0.5rem 2.5rem;
  position: relative;
  margin-bottom: 0.5rem; }

.cmp-finalizehelp-arrow {
  border-bottom: 10px solid #e3e3e3;
  border-left: 10px solid transparent;
  border-right: 10px solid transparent;
  border-top: none;
  height: 0;
  left: 50%;
  position: absolute;
  top: 0;
  -ms-transform: translate(-50%, -100%);
      transform: translate(-50%, -100%);
  width: 0; }
  @media only screen and (min-width: 640px) {
    .cmp-finalizehelp-arrow {
      border-bottom: 10px solid transparent; } }
  @media only screen and (min-width: 640px) {
    .cmp-finalizehelp-arrow {
      border-left: none; } }
  @media only screen and (min-width: 640px) {
    .cmp-finalizehelp-arrow {
      border-right: 10px solid #e3e3e3; } }
  @media only screen and (min-width: 640px) {
    .cmp-finalizehelp-arrow {
      border-top: 10px solid transparent; } }
  @media only screen and (min-width: 640px) {
    .cmp-finalizehelp-arrow {
      left: -10px; } }
  @media only screen and (min-width: 640px) {
    .cmp-finalizehelp-arrow {
      top: 50%; } }
  @media only screen and (min-width: 640px) {
    .cmp-finalizehelp-arrow {
      -ms-transform: translate(0, -50%);
          transform: translate(0, -50%); } }

.cmp-finalizehelp-icon {
  font-size: 1.25rem;
  left: 0.5rem;
  position: absolute;
  top: 0.5rem; }

.cmp-filtercontrols .cmp-chip {
  margin-top: auto; }

.cmp-filtercontrols.withintro {
  padding: 0.5rem 0.5rem 0.5rem 2.5rem;
  position: relative; }

.cmp-filtercontrols.toggleable {
  position: relative; }
  .cmp-filtercontrols.toggleable .cmp-filtercontrols-content {
    padding: 1rem;
    position: absolute;
    z-index: 200; }

.cmp-filtercontrols-anchor {
  background-color: #e7e7e7;
  border: 1px solid transparent;
  border-radius: 0.75rem;
  color: #333;
  display: inline-block;
  margin-bottom: 0.35rem;
  margin-left: 0.75rem;
  padding: 0.35rem 0.75rem 0.375rem;
  position: relative; }
  .cmp-filtercontrols-anchor.checkable {
    padding-left: 2rem; }
  .cmp-filtercontrols-anchor:not(.active) {
    background-color: transparent;
    border: 1px solid #e7e7e7; }
    .cmp-filtercontrols-anchor:not(.active) .cmp-filtercontrols-check {
      background-color: transparent; }
    .cmp-filtercontrols-anchor:not(.active) .cmp-filtercontrols-icon {
      display: none; }

.cmp-filtercontrols-check {
  background-color: #fefefe;
  border: 1px solid #e7e7e7;
  border-radius: 50%;
  height: 1.2rem;
  left: 0.5rem;
  position: absolute;
  top: 0.325rem;
  width: 1.2rem; }
  .cmp-filtercontrols-check .cmp-filtercontrols-icon {
    color: #757575;
    margin: 0;
    left: 0;
    position: absolute;
    right: 0;
    text-align: center;
    top: 0.1rem; }

.cmp-filtercontrols-dates.row {
  margin-left: -0.25rem;
  margin-right: -0.25rem; }

.cmp-filtercontrols-dates .column, .cmp-filtercontrols-dates .columns {
  padding: 0.25rem; }

.cmp-filtercontrols-group {
  font-size: 0.875rem;
  margin-right: 1rem;
  text-transform: uppercase; }

.cmp-filtercontrols-intro {
  bottom: 0;
  left: 1.75rem;
  position: absolute;
  text-align: center;
  text-transform: uppercase;
  top: 0;
  -ms-transform: rotate(270deg);
      transform: rotate(270deg); }

.cmp-filtercontrols-radio {
  background-color: #eee;
  border-radius: 2px;
  padding: 0.75rem 0 0.75rem 0.875rem;
  display: inline-block;
  margin: 0.1rem;
  padding: 0.4rem 0.6rem; }
  .cmp-filtercontrols-radio label {
    padding-left: 1.25rem; }

.cmp-filtercontrols-section {
  margin-bottom: 0.75rem; }
  .cmp-filtercontrols-section.small {
    max-width: 22.5rem; }

.cmp-filtercontrols-select {
  display: block; }
  .cmp-filtercontrols-select.small {
    height: auto;
    max-width: 20rem; }

.cmp-filterswitch {
  margin: 1.25rem 0;
  padding-right: 5rem;
  position: relative; }
  .cmp-filterswitch .switch {
    position: absolute;
    right: 0;
    top: 50%;
    -ms-transform: translateY(-50%);
        transform: translateY(-50%); }

.cmp-flatpagesell {
  position: relative; }

@media only screen and (min-width: 640px) {
  .cmp-flatpagesell-content {
    margin-left: 20rem; } }

.cmp-flatpagesell-grid.row {
  padding: 0.5rem 0; }

.cmp-flatpagesell-icon {
  background-color: #f1f8fd;
  border-radius: 50%;
  left: 0;
  padding: 0.25rem;
  position: absolute; }

.cmp-flatpagesell-image {
  position: absolute;
  -ms-transform: scaleX(-1);
      transform: scaleX(-1);
  width: 18rem; }

.cmp-flatpagesell-point {
  padding-left: 2.25rem;
  position: relative; }

.cmp-flatpagesolution-button {
  margin-top: 1rem; }
  @media only screen and (min-width: 640px) {
    .cmp-flatpagesolution-button {
      margin-top: 2rem; } }

.cmp-flatpagesolution-content {
  margin-left: 0;
  margin-top: 1rem;
  padding: 0 0.5rem; }
  @media only screen and (min-width: 640px) {
    .cmp-flatpagesolution-content {
      margin-left: 15rem; } }
  @media only screen and (min-width: 640px) {
    .cmp-flatpagesolution-content {
      margin-top: 2rem; } }
  @media only screen and (min-width: 960px) {
    .cmp-flatpagesolution-content {
      padding: 0 1rem; } }

.cmp-flatpagesolution-element {
  padding-top: 0.5rem; }
  @media only screen and (min-width: 640px) {
    .cmp-flatpagesolution-element {
      padding-top: 1rem; } }

.cmp-flatpagesolution-image {
  height: 16rem;
  left: 4rem;
  position: absolute;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%);
  width: 8rem; }

.cmp-flatpagesolution-tag {
  background-color: #fbe4df;
  border-radius: 1rem;
  color: #e75635;
  display: inline-block;
  font-size: 1rem;
  padding: 0.375rem 0.75rem;
  margin: 0 0 0.5rem; }

.cmp-flatpagesolution-wrapper {
  position: relative; }

.cmp-flatpageteam {
  position: relative; }

.cmp-flatpageteam-buttons {
  margin-top: 0.5rem; }

.cmp-flatpageteam-content {
  margin-right: 0;
  margin-top: 0.75rem; }
  @media only screen and (min-width: 640px) {
    .cmp-flatpageteam-content {
      margin-right: 20rem; } }
  @media only screen and (min-width: 640px) {
    .cmp-flatpageteam-content {
      margin-top: 0; } }

.cmp-flatpageteam-image {
  background-repeat: no-repeat;
  background-position: center;
  background-size: cover;
  width: 100%;
  border: 3px solid #e3e3e3;
  border-radius: 50%;
  display: inline-block;
  height: 3rem;
  position: relative;
  width: 3rem; }
  .cmp-flatpageteam-image:nth-child(1) {
    right: 0; }
  .cmp-flatpageteam-image:nth-child(2) {
    right: 1rem; }
  .cmp-flatpageteam-image:nth-child(3) {
    right: 2rem; }
  .cmp-flatpageteam-image:nth-child(4) {
    right: 3rem; }
  @media only screen and (min-width: 640px) {
    .cmp-flatpageteam-image.large {
      height: 6rem; } }
  @media only screen and (min-width: 640px) {
    .cmp-flatpageteam-image.large {
      width: 6rem; } }
  @media only screen and (min-width: 640px) {
    .cmp-flatpageteam-image.large:nth-child(2) {
      right: 2rem; } }
  @media only screen and (min-width: 640px) {
    .cmp-flatpageteam-image.large:nth-child(3) {
      right: 4rem; } }
  @media only screen and (min-width: 640px) {
    .cmp-flatpageteam-image.large:nth-child(4) {
      right: 6rem; } }

@media only screen and (min-width: 640px) {
  .cmp-flatpageteam-images {
    position: absolute; } }

@media only screen and (min-width: 640px) {
  .cmp-flatpageteam-images {
    right: -6rem; } }

@media only screen and (min-width: 640px) {
  .cmp-flatpageteam-images {
    top: 50%; } }

@media only screen and (min-width: 640px) {
  .cmp-flatpageteam-images {
    -ms-transform: translateY(-50%);
        transform: translateY(-50%); } }

.cmp-flatpagetexticononside {
  position: relative; }

.cmp-flatpagetexticononside-content {
  margin-left: 4rem; }

.cmp-flatpagetexticononside-icon {
  font-size: 2.5rem;
  margin-bottom: 0.5rem;
  position: absolute; }
  @media only screen and (min-width: 960px) {
    .cmp-flatpagetexticononside-icon {
      margin-bottom: 1rem; } }

.cmp-flatpageworld-content {
  padding: 0 0 1rem;
  vertical-align: top; }
  @media only screen and (min-width: 640px) {
    .cmp-flatpageworld-content {
      display: inline-block; } }
  @media only screen and (min-width: 640px) {
    .cmp-flatpageworld-content {
      padding: 7.5rem 2rem 0 0; } }
  @media only screen and (min-width: 640px) {
    .cmp-flatpageworld-content {
      width: calc(100% - 20rem); } }

@media only screen and (min-width: 640px) {
  .cmp-flatpageworld-grid {
    display: inline-block; } }

.cmp-flatpageworld-grid .column.shifted-down, .cmp-flatpageworld-grid .shifted-down.columns {
  position: relative; }
  @media only screen and (min-width: 640px) {
    .cmp-flatpageworld-grid .column.shifted-down, .cmp-flatpageworld-grid .shifted-down.columns {
      top: 4rem; } }

.cmp-flatpageworld-grid .column.shifted-up, .cmp-flatpageworld-grid .shifted-up.columns {
  position: relative; }
  @media only screen and (min-width: 640px) {
    .cmp-flatpageworld-grid .column.shifted-up, .cmp-flatpageworld-grid .shifted-up.columns {
      top: -2rem; } }

.cmp-flatpageworld-image {
  background-repeat: no-repeat;
  background-position: center;
  background-size: cover;
  width: 100%;
  border-radius: 2px;
  height: 8rem;
  width: 100%; }
  @media only screen and (min-width: 640px) {
    .cmp-flatpageworld-image {
      height: 6rem; } }
  @media only screen and (min-width: 640px) {
    .cmp-flatpageworld-image {
      width: 9rem; } }
  .cmp-flatpageworld-image.vertical {
    height: 8rem; }
    @media only screen and (min-width: 640px) {
      .cmp-flatpageworld-image.vertical {
        height: 12rem; } }

.cmp-footersection {
  margin-top: 2rem; }
  @media only screen and (min-width: 1280px) {
    .cmp-footersection {
      margin-top: 4rem; } }
  .cmp-footersection.large-spacing {
    margin-top: 4rem; }
    @media only screen and (min-width: 1280px) {
      .cmp-footersection.large-spacing {
        margin-top: 8rem; } }

input[type=checkbox].cmp-footersection-checkbox:checked + .cmp-footersection-label {
  display: none; }

input[type=checkbox].cmp-footersection-checkbox ~ .cmp-footersection-content {
  display: none; }

input[type=checkbox].cmp-footersection-checkbox:checked ~ .cmp-footersection-content {
  display: block; }

input[type=checkbox].cmp-footersection-checkbox + .cmp-footersection-label {
  color: #757575;
  display: block;
  font-size: 1rem;
  padding-bottom: 2rem;
  padding-left: 0;
  text-align: center; }
  input[type=checkbox].cmp-footersection-checkbox + .cmp-footersection-label:before {
    display: none; }
  input[type=checkbox].cmp-footersection-checkbox + .cmp-footersection-label:hover {
    color: #aaa; }

.cmp-footerlinks {
  color: #757575;
  margin-top: 1rem;
  padding-left: 0.125rem;
  padding-right: 0.125rem; }
  @media only screen and (min-width: 640px) {
    .cmp-footerlinks {
      padding-left: 0; } }
  @media only screen and (min-width: 640px) {
    .cmp-footerlinks {
      padding-right: 0; } }

.cmp-footerlinks-linkgrid {
  color: #757575;
  display: inline-block;
  padding: 0.5rem 0.75rem 0.5rem 0; }
  @media only screen and (min-width: 960px) {
    .cmp-footerlinks-linkgrid {
      display: block; } }
  .cmp-footerlinks-linkgrid:hover {
    color: #292929; }
  .cmp-footerlinks-linkgrid.white {
    color: #fefefe; }
    .cmp-footerlinks-linkgrid.white:hover {
      color: inherit; }

.cmp-footerlinks-linkline {
  color: #757575;
  display: inline-block;
  padding: 0.5rem 0.75rem 0.5rem 0; }
  .cmp-footerlinks-linkline:hover {
    color: #292929; }

.cmp-footerlinks-linkspacing {
  margin-top: 1.75rem; }
  @media only screen and (min-width: 960px) {
    .cmp-footerlinks-linkspacing {
      margin-top: 0; } }

.cmp-footerlinks-logobrand {
  height: 1.75rem; }

.cmp-footerlinks-logogrid.row {
  margin-left: -0.5rem;
  margin-right: -0.5rem; }

.cmp-footerlinks-logogrid .column, .cmp-footerlinks-logogrid .columns {
  padding: 0.5rem;
  position: relative; }

.cmp-footerlinks-logomain {
  margin-bottom: 1rem;
  width: 100%; }

.cmp-footerlinks-logotext {
  font-size: 0.875rem;
  text-transform: uppercase;
  margin: 1rem auto 0; }

.cmp-footerlinks-logowrapper {
  max-width: 15rem;
  width: 75%; }

.cmp-footerlinks-newsletter {
  margin: 1rem 0rem 0.25rem; }

.cmp-footerlinks-sectiongrid.colored {
  background-color: #555;
  background-repeat: no-repeat;
  background-position: center center;
  background-attachment: scroll;
  background-size: cover;
  color: #fefefe; }
  .cmp-footerlinks-sectiongrid.colored a {
    color: #fefefe; }

.cmp-footerlinks-sectiongrid.padded {
  padding-bottom: 3rem;
  padding-top: 3rem; }

.cmp-footerlinks-sharingicon {
  color: #757575;
  font-size: 1rem;
  padding: 0.5rem 0.75rem 0.5rem 0; }
  @media only screen and (min-width: 640px) {
    .cmp-footerlinks-sharingicon {
      font-size: 1.2rem; } }

.cmp-footerlinks-sharingrow {
  margin-bottom: 1rem;
  text-align: center; }

.cmp-footerlinks-titlegrid {
  margin-bottom: 0.5rem; }

.cmp-footernewsletter {
  color: #777;
  padding: 2rem 0 1rem;
  text-align: center; }

.cmp-footernewsletter-checkbox {
  margin-top: 0.5rem; }
  .cmp-footernewsletter-checkbox i {
    display: none; }

.cmp-footernewsletter-comment {
  margin-top: 1rem; }

.cmp-footernewsletter-email input {
  background-color: transparent;
  margin-bottom: 0.5rem; }
  @media only screen and (min-width: 640px) {
    .cmp-footernewsletter-email input {
      display: inline-block; } }
  @media only screen and (min-width: 640px) {
    .cmp-footernewsletter-email input {
      margin-bottom: 0; } }
  @media only screen and (min-width: 640px) {
    .cmp-footernewsletter-email input {
      margin-right: 1rem; } }
  @media only screen and (min-width: 640px) {
    .cmp-footernewsletter-email input {
      width: 25rem; } }

.cmp-footernewsletter-email label {
  display: none; }

.cmp-footernewsletter-title {
  margin-bottom: 1rem;
  text-transform: uppercase; }

.cmp-headersided {
  margin-bottom: 5rem; }
  @media only screen and (min-width: 960px) {
    .cmp-headersided {
      margin-bottom: 10rem; } }

.cmp-headersided-icon {
  color: #e75635;
  margin-bottom: 0.25rem;
  -ms-transform: rotate(180deg);
      transform: rotate(180deg); }
  .cmp-headersided-icon.material-icons {
    font-size: 1.75rem; }
  .cmp-headersided-icon.purple {
    color: #b87af5; }

.cmp-headersided {
  position: relative; }

.cmp-headersided-image {
  height: 100%;
  object-fit: cover;
  position: absolute;
  width: 100%; }

.cmp-headersided-image {
  opacity: 0.25;
  z-index: -1; }

.cmp-headersided-aside {
  background: #fbe4df;
  padding: 1rem 1.5rem;
  margin-top: 1.5rem; }
  .cmp-headersided-aside.purple {
    background: #f7f1ff; }
  .cmp-headersided-aside.secondary {
    background-color: #f1f8fd; }
  @media only screen and (min-width: 640px) {
    .cmp-headersided-aside {
      margin-top: 0; } }

.cmp-headersided-grid {
  padding-bottom: 2.5rem;
  padding-top: 2.5rem; }

.cmp-headersided-main {
  padding: 1rem 1.5rem; }

.cmp-headersided-text {
  margin-bottom: 0.875rem; }
  @media only screen and (min-width: 960px) {
    .cmp-headersided-text {
      margin-bottom: 1.25rem; } }

.cmp-headerwithactions {
  margin-bottom: 0; }
  @media only screen and (min-width: 960px) {
    .cmp-headerwithactions {
      margin-bottom: 8rem; } }
  .cmp-headerwithactions .cmp-inputiconed-icon {
    opacity: 1; }

.cmp-headerwithactions {
  position: relative; }

.cmp-headerwithactions-image {
  height: 100%;
  object-fit: cover;
  position: absolute;
  width: 100%; }

.cmp-headerwithactions-action {
  margin-left: auto;
  margin-right: auto;
  padding: 1.5rem;
  position: relative;
  width: 100%; }
  @media only screen and (min-width: 960px) {
    .cmp-headerwithactions-action {
      margin-left: 0; } }
  @media only screen and (min-width: 960px) {
    .cmp-headerwithactions-action {
      margin-right: 0; } }
  @media only screen and (min-width: 960px) {
    .cmp-headerwithactions-action {
      width: 30rem; } }
  @media only screen and (min-width: 960px) {
    .cmp-headerwithactions-action.large {
      width: 40rem; } }

.cmp-headerwithactions-button {
  padding: 1rem 0;
  width: 100%; }

.cmp-headerwithactions-comment {
  margin-top: 1rem; }
  @media only screen and (min-width: 960px) {
    .cmp-headerwithactions-comment {
      margin-top: 2rem; } }

.cmp-headerwithactions-container {
  padding-bottom: 1.25rem;
  padding-top: 1.25rem; }
  @media only screen and (min-width: 960px) {
    .cmp-headerwithactions-container {
      padding-bottom: 2.5rem; } }
  @media only screen and (min-width: 960px) {
    .cmp-headerwithactions-container {
      padding-top: 2.5rem; } }

.cmp-headerwithactions-icon {
  font-size: 2.5rem; }

.cmp-headerwithactions-text {
  margin-bottom: 1rem; }
  @media only screen and (min-width: 960px) {
    .cmp-headerwithactions-text {
      margin-bottom: 2rem; } }

.cmp-headerwithimage {
  padding: 0; }
  @media only screen and (min-width: 1280px) {
    .cmp-headerwithimage {
      margin: 0 auto; } }
  @media only screen and (min-width: 1280px) {
    .cmp-headerwithimage {
      max-width: 90rem; } }
  @media only screen and (min-width: 960px) {
    .cmp-headerwithimage {
      padding: 0 0.75rem 0.75rem; } }

.cmp-headerwithimage-aside {
  background-color: #fefefe; }
  @media only screen and (min-width: 1280px) {
    .cmp-headerwithimage-aside {
      float: right; } }
  @media only screen and (min-width: 1280px) {
    .cmp-headerwithimage-aside {
      height: 100%; } }
  @media only screen and (min-width: 1280px) {
    .cmp-headerwithimage-aside {
      position: relative; } }
  @media only screen and (min-width: 1280px) {
    .cmp-headerwithimage-aside {
      width: 35rem; } }

.cmp-headerwithimage-asidecontent {
  padding: 1rem; }
  @media only screen and (min-width: 1280px) {
    .cmp-headerwithimage-asidecontent {
      bottom: 0; } }
  @media only screen and (min-width: 1280px) {
    .cmp-headerwithimage-asidecontent {
      padding: 1.5rem 2.5rem; } }
  @media only screen and (min-width: 1280px) {
    .cmp-headerwithimage-asidecontent {
      position: absolute; } }
  @media only screen and (min-width: 1280px) {
    .cmp-headerwithimage-asidecontent {
      width: 100%; } }

.cmp-headerwithimage-main {
  height: 12rem; }
  @media only screen and (min-width: 1280px) {
    .cmp-headerwithimage-main {
      float: left; } }
  @media only screen and (min-width: 640px) {
    .cmp-headerwithimage-main {
      height: 15rem; } }
  @media only screen and (min-width: 960px) {
    .cmp-headerwithimage-main {
      height: 20rem; } }
  @media only screen and (min-width: 1280px) {
    .cmp-headerwithimage-main {
      height: 100%; } }
  @media only screen and (min-width: 1280px) {
    .cmp-headerwithimage-main {
      width: calc(100% - 35rem); } }

.cmp-headerwithimage-main {
  position: relative; }

.cmp-headerwithimage-mainimage {
  height: 100%;
  object-fit: cover;
  position: absolute;
  width: 100%; }

@media only screen and (min-width: 1280px) {
  .cmp-headerwithimage-wrapper {
    height: 25rem; } }

@media only screen and (min-width: 1600px) {
  .cmp-headerwithimage-wrapper {
    height: 30rem; } }

@media only screen and (min-width: 1280px) {
  .cmp-headerwithimage-wrapper:after {
    clear: both; } }

@media only screen and (min-width: 1280px) {
  .cmp-headerwithimage-wrapper:after {
    content: ""; } }

@media only screen and (min-width: 1280px) {
  .cmp-headerwithimage-wrapper:after {
    display: table; } }

.cmp-headerwithimage {
  margin-bottom: 2.5rem; }
  @media only screen and (min-width: 640px) {
    .cmp-headerwithimage {
      margin-bottom: 4rem; } }

.cmp-headerwithimage-comment {
  color: #757575;
  font-size: 0.875rem;
  margin-top: 0.5rem;
  text-align: left;
  text-align: center; }
  .cmp-headerwithimage-comment a {
    font-size: 0.875rem; }

.cmp-headerwithimage-gallery, .cmp-headerwithimage-wishlist {
  padding: 0.5rem 0.75rem;
  position: absolute;
  right: 0; }
  @media only screen and (min-width: 960px) {
    .cmp-headerwithimage-gallery, .cmp-headerwithimage-wishlist {
      padding: 0.75rem 1rem; } }

.cmp-headerwithimage-gallery {
  color: #fefefe;
  bottom: 0;
  font-size: 1.25rem;
  pointer-events: none; }
  @media only screen and (min-width: 960px) {
    .cmp-headerwithimage-gallery {
      font-size: 1.5rem; } }

.cmp-headerwithimage-main {
  background-color: #f7f7f7;
  position: relative; }

.cmp-headerwithimage-missing {
  color: #aaa;
  left: 0;
  position: absolute;
  right: 0;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%);
  text-align: center; }

.cmp-headerwithimage-missingicon {
  font-size: 3rem; }

.cmp-headerwithimage-spaced {
  margin-left: 0.75rem; }

.cmp-headerwithimage-wishlist {
  color: #fefefe;
  top: 0;
  font-size: 1.25rem; }
  @media only screen and (min-width: 960px) {
    .cmp-headerwithimage-wishlist {
      font-size: 1.5rem; } }

@media only screen and (min-width: 1280px) {
  .cmp-headerwithimage-wrapper {
    height: 30rem; } }

.cmp-hirechanges-container {
  margin-bottom: 1rem; }

.cmp-hirecoupon {
  margin-bottom: 0.75rem;
  position: relative; }
  .cmp-hirecoupon input[type=checkbox] {
    border: 0;
    clip: rect(0 0 0 0);
    height: 1px;
    width: 1px;
    margin: -1px;
    overflow: hidden;
    padding: 0;
    position: absolute; }
  .cmp-hirecoupon input[type=checkbox]:checked ~ .cmp-hirecoupon-area {
    display: block;
    padding-bottom: 0.225rem; }
  .cmp-hirecoupon input[type=checkbox] + label {
    text-decoration: underline;
    color: #757575;
    display: block;
    padding-left: 0; }
    .cmp-hirecoupon input[type=checkbox] + label:hover {
      color: #aaa; }
    .cmp-hirecoupon input[type=checkbox] + label::before {
      display: none; }
    .cmp-hirecoupon input[type=checkbox] + label i {
      font-size: 1.25rem;
      position: relative;
      top: 0.3rem; }
  .cmp-hirecoupon input[type=checkbox]:checked + label {
    display: none; }
  .cmp-hirecoupon input[type=checkbox]:checked ~ .cmp-hirecoupon-error {
    display: block; }
  .cmp-hirecoupon input[type=checkbox]:checked ~ .cmp-hirecoupon-message {
    display: block; }

.cmp-hirecoupon-area {
  display: none;
  margin: 0; }
  .cmp-hirecoupon-area label {
    display: block; }
  .cmp-hirecoupon-area input[type=text] {
    height: auto;
    padding: 0.925rem 1.2rem !important;
    width: 100%; }

.cmp-hirecoupon-error {
  display: none;
  margin-top: 0.25rem; }

.cmp-hirecoupon-message {
  display: none;
  margin-top: 0.25rem; }

.cmp-hireform-autosubmit label {
  color: #aaa; }

.cmp-hireform-availability {
  color: #757575;
  font-size: 0.875rem;
  margin: 0.25rem 0; }

.cmp-hireform-buttons {
  margin-top: 0.5rem; }

.cmp-hireform-grid .column, .cmp-hireform-grid .columns {
  padding-bottom: 0.25rem;
  padding-top: 0.25rem; }

.cmp-hireform-help {
  background-color: #e3e3e3;
  padding: 0.5rem 0.5rem 0.5rem 2.5rem;
  position: relative;
  margin-bottom: 0.5rem; }
  .cmp-hireform-help .cmp-hireform-help-arrow {
    border-bottom: 10px solid #e3e3e3;
    border-left: 10px solid transparent;
    border-right: 10px solid transparent;
    border-top: none;
    height: 0;
    left: 50%;
    position: absolute;
    top: 0;
    -ms-transform: translate(-50%, -100%);
        transform: translate(-50%, -100%);
    width: 0; }
    @media only screen and (min-width: 640px) {
      .cmp-hireform-help .cmp-hireform-help-arrow {
        border-bottom: 10px solid transparent; } }
    @media only screen and (min-width: 640px) {
      .cmp-hireform-help .cmp-hireform-help-arrow {
        border-left: none; } }
    @media only screen and (min-width: 640px) {
      .cmp-hireform-help .cmp-hireform-help-arrow {
        border-right: 10px solid #e3e3e3; } }
    @media only screen and (min-width: 640px) {
      .cmp-hireform-help .cmp-hireform-help-arrow {
        border-top: 10px solid transparent; } }
    @media only screen and (min-width: 640px) {
      .cmp-hireform-help .cmp-hireform-help-arrow {
        left: -10px; } }
    @media only screen and (min-width: 640px) {
      .cmp-hireform-help .cmp-hireform-help-arrow {
        top: 50%; } }
    @media only screen and (min-width: 640px) {
      .cmp-hireform-help .cmp-hireform-help-arrow {
        -ms-transform: translate(0, -50%);
            transform: translate(0, -50%); } }
  .cmp-hireform-help .cmp-hireform-help-icon {
    font-size: 1.25rem;
    left: 0.5rem;
    position: absolute;
    top: 0.5rem; }

.cmp-hireform-packagecontainer {
  margin: 2rem 0; }
  .cmp-hireform-packagecontainer .cmp-eventpackage-sectioncontent {
    padding-left: 0; }
  .cmp-hireform-packagecontainer .cmp-eventpackage-sectiontitletext {
    margin-left: 0; }

@media only screen and (min-width: 640px) {
  .cmp-hireform-openreveal {
    margin-top: 1.25rem; } }

.cmp-hireform-sectionsecondarytext {
  margin-bottom: 0.5rem; }

.cmp-hireform-sectiontitle {
  margin-bottom: 0.25rem; }

.cmp-hireform-title {
  margin-bottom: 0.75rem; }

.cmp-hiretable table {
  width: 100%; }

.cmp-hiretable th {
  padding: .7em .8em;
  text-align: left;
  font-weight: normal; }

.cmp-hiretable td {
  border-top: 1px solid #ccc; }

.cmp-hiretable-highlight {
  text-transform: uppercase; }

.cmp-hiretable-total {
  background-color: #f7f7f7; }

.cmp-hirerecaptable td {
  padding: 0.25rem; }

.cmp-imgunavailable-overlay {
  position: absolute;
  width: 100%;
  height: 100%;
  background-color: #333; }

.cmp-imgunavailable-placeholdertext {
  position: absolute;
  top: 50%;
  left: 50%;
  -ms-transform: translate(-50%, -50%);
      transform: translate(-50%, -50%);
  color: #fefefe;
  text-align: center; }

.cmp-imageuploader-actiontext {
  color: #50aaeb; }

.cmp-imageuploader-maintext {
  margin-top: 0.5rem; }

.cmp-imageuploader-subtext {
  font-size: 0.875rem; }

.cmp-imageuploader-wrapper {
  color: #757575; }

.cmp-infowindow {
  width: 15rem; }

.cmp-infowindow-image {
  width: 100%; }

.cmp-infowindow-text {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap;
  margin: 0 !important;
  padding-top: 0.2rem; }

.cmp-inputiconed {
  position: relative; }
  .cmp-inputiconed input:hover {
    cursor: text; }
  .cmp-inputiconed select + .cmp-inputiconed-icon {
    right: 1.5rem; }

.cmp-inputiconed-icon {
  color: #333;
  display: none;
  font-size: 1.25rem;
  margin: 0.2rem;
  opacity: 0.5;
  pointer-events: none;
  position: absolute;
  right: 0.75rem;
  top: 0.65rem; }
  @media only screen and (min-width: 640px) {
    .cmp-inputiconed-icon {
      display: block; } }

.cmp-inputiconed-iconmaterial {
  color: #757575;
  pointer-events: none;
  margin-left: 0;
  margin-right: 0.5rem; }
  .cmp-inputiconed-iconmaterial.material-icons {
    font-size: 1.25rem; }

.cmp-invoiceaddresses textarea {
  height: 2.5rem; }

input[type=checkbox].cmp-invoiceaddresses-checkbox:checked + .cmp-invoiceaddresses-label {
  display: none; }

input[type=checkbox].cmp-invoiceaddresses-checkbox + .cmp-invoiceaddresses-label {
  text-decoration: underline;
  padding-left: 1.1rem; }
  input[type=checkbox].cmp-invoiceaddresses-checkbox + .cmp-invoiceaddresses-label:before {
    display: none; }

input[type=checkbox].cmp-invoiceaddresses-checkbox ~ .cmp-invoiceaddresses-fields {
  display: none; }

input[type=checkbox].cmp-invoiceaddresses-checkbox:checked ~ .cmp-invoiceaddresses-fields {
  display: block; }

input[type=checkbox].cmp-invoiceaddresses-checkbox ~ .cmp-invoiceaddresses-list {
  display: none; }

input[type=checkbox].cmp-invoiceaddresses-checkbox:checked ~ .cmp-invoiceaddresses-list {
  display: block; }

.cmp-invoiceaddresses-comment {
  margin-bottom: 0.5rem; }

.cmp-invoiceaddresses-element {
  cursor: pointer;
  padding: 0.5rem; }

.cmp-invoiceaddresses-explanation {
  margin: 1rem 0 0.5rem 0; }

.cmp-invoiceaddresses-existing {
  border-left: 1px solid #ccc;
  color: #757575;
  font-size: 0.875rem;
  margin-bottom: 0.5rem;
  margin-left: 0.5rem;
  padding-left: 0.5rem; }
  .cmp-invoiceaddresses-existing > :first-child {
    font-size: bold; }

.cmp-invoiceaddresses-grid.row {
  margin-left: -0.5rem;
  margin-right: -0.5rem; }

.cmp-invoiceaddresses-grid .column, .cmp-invoiceaddresses-grid .columns {
  padding: 0.5rem; }

.cmp-invoiceaddresses-section {
  margin-bottom: 0.75rem; }

.cmp-invoiceaddressedit-card {
  font-size: 0.875rem;
  padding: 0.5rem;
  position: relative; }

.cmp-invoiceaddressedit-delete {
  font-size: 1.25rem;
  position: absolute;
  top: 1rem;
  right: 1rem; }

.cmp-invoiceinstructions {
  padding: 1.25rem 2.5rem; }

.cmp-invoiceinstructions-bank {
  background-color: #757575;
  background-repeat: no-repeat;
  background-position: center center;
  background-attachment: scroll;
  background-size: cover;
  border-radius: 0.5rem;
  color: white;
  margin: 1.25rem auto 0;
  max-width: 24rem;
  padding: 0.75rem 1rem; }

.cmp-invoiceinstructions-comment {
  font-size: 0.875rem;
  margin: 0.25rem auto 0;
  max-width: 24rem; }

.cmp-invoiceinstructions-company {
  margin-bottom: 2.5rem; }

.cmp-invoiceinstructions-label {
  display: block;
  font-size: 0.875rem;
  margin: 0.5rem 0 0.25rem; }

.cmp-invoiceinstructions-text {
  margin-top: 0.75rem; }

.cmp-invoiceinstructions-title {
  margin-top: 1.25rem; }

.cmp-kpi {
  padding: 0.5rem 0.5rem 0.5rem 0.75rem;
  position: relative; }
  @media only screen and (min-width: 640px) {
    .cmp-kpi {
      padding: 0.75rem 0.75rem 0.75rem 1.25rem; } }

.cmp-kpi-circle {
  border: 4px solid transparent;
  border-left-color: #e3e3e3;
  border-radius: 50%;
  border-right-color: #e3e3e3;
  border-top-color: #e3e3e3;
  position: absolute;
  height: 100%;
  right: 0;
  top: 0;
  width: 100%; }
  .cmp-kpi-circle.rotate-1 {
    -ms-transform: rotate(22.5deg);
        transform: rotate(22.5deg); }
  .cmp-kpi-circle.rotate-2 {
    -ms-transform: rotate(-157.5deg);
        transform: rotate(-157.5deg); }
  .cmp-kpi-circle.rotate-3 {
    -ms-transform: rotate(112.5deg);
        transform: rotate(112.5deg); }
  .cmp-kpi-circle.rotate-4 {
    -ms-transform: rotate(-67.5deg);
        transform: rotate(-67.5deg); }

.cmp-kpi-icon {
  color: #aaa;
  height: 2.2rem;
  position: absolute;
  right: 0.5rem;
  text-align: center;
  top: 0.5rem;
  width: 2.2rem; }
  @media only screen and (min-width: 640px) {
    .cmp-kpi-icon {
      right: 0.75rem; } }
  @media only screen and (min-width: 640px) {
    .cmp-kpi-icon {
      top: 0.75rem; } }
  .cmp-kpi-icon i {
    margin: 0.6rem 0; }

.cmp-kpi-text {
  margin-right: 2.75rem; }

.cmp-kpi-title {
  font-size: 0.875rem;
  margin-bottom: 0.15rem; }

.cmp-kpi-value {
  font-weight: bold; }

.cmp-landingbulleticoned {
  margin-bottom: 0.75rem;
  position: relative; }
  @media only screen and (min-width: 960px) {
    .cmp-landingbulleticoned {
      margin-bottom: 1.5rem; } }

.cmp-landingbulleticoned-content {
  margin-left: 3rem; }
  @media only screen and (min-width: 960px) {
    .cmp-landingbulleticoned-content {
      margin-left: 4.5rem; } }

.cmp-landingbulleticoned-svg {
  height: 1.5rem;
  left: 0.5rem;
  position: absolute;
  top: 0.5rem;
  width: 1.5rem; }
  @media only screen and (min-width: 960px) {
    .cmp-landingbulleticoned-svg {
      height: 2.25rem; } }
  @media only screen and (min-width: 960px) {
    .cmp-landingbulleticoned-svg {
      left: 0.75rem; } }
  @media only screen and (min-width: 960px) {
    .cmp-landingbulleticoned-svg {
      width: 2.25rem; } }

.cmp-mapmaker {
  position: relative;
  -ms-transform: translateX(-50%);
      transform: translateX(-50%); }

.cmp-mapmaker-text {
  font-size: 1rem;
  font-weight: bold;
  left: 0;
  position: absolute;
  right: 0;
  text-align: center;
  top: 5px; }

.cmp-multispaceslist-wrapper {
  margin-top: 0.5rem;
  margin-bottom: 1rem; }

.cmp-navigation {
  background-color: #fefefe; }
  .cmp-navigation.sticky {
    left: 0;
    position: fixed;
    top: 0;
    width: 100%;
    z-index: 400; }
    .cmp-navigation.sticky.bottom {
      box-shadow: 0 -4px 8px 0 rgba(0, 0, 0, 0.12), 0 -8px 24px 0 rgba(0, 0, 0, 0.08);
      bottom: 0;
      top: auto; }
      @media only screen and (min-width: 960px) {
        .cmp-navigation.sticky.bottom {
          height: 5.75rem; } }
      @media only screen and (min-width: 960px) {
        .cmp-navigation.sticky.bottom .top-bar {
          padding-bottom: 1.5rem; } }
      @media only screen and (min-width: 960px) {
        .cmp-navigation.sticky.bottom .top-bar {
          padding-top: 1.5rem; } }
      .cmp-navigation.sticky.bottom .top-bar .top-bar-right.padded {
        padding-right: 4.5rem; }
        @media only screen and (min-width: 1600px) {
          .cmp-navigation.sticky.bottom .top-bar .top-bar-right.padded {
            padding-right: 0; } }
    .cmp-navigation.sticky .top-bar {
      background-color: transparent;
      box-shadow: none;
      padding: 0.5rem;
      position: static; }
      @media only screen and (min-width: 1280px) {
        .cmp-navigation.sticky .top-bar {
          margin: 0 auto; } }
      @media only screen and (min-width: 1280px) {
        .cmp-navigation.sticky .top-bar {
          max-width: 90rem; } }
      .cmp-navigation.sticky .top-bar .top-bar-left .cmp-navigation-homelink {
        margin-right: 0.5rem;
        width: auto; }
      .cmp-navigation.sticky .top-bar .top-bar-left select {
        width: 15rem; }
  .cmp-navigation .top-bar {
    left: 0.75rem;
    padding: 0.625rem 0.5rem;
    position: absolute;
    right: 0.75rem;
    top: 0.75rem;
    z-index: 600; }
    @media only screen and (min-width: 640px) {
      .cmp-navigation .top-bar {
        left: auto; } }
    @media only screen and (min-width: 960px) {
      .cmp-navigation .top-bar {
        position: static; } }
    @media only screen and (min-width: 960px) {
      .cmp-navigation .top-bar {
        right: auto; } }
    @media only screen and (min-width: 960px) {
      .cmp-navigation .top-bar {
        top: auto; } }
    @media only screen and (min-width: 960px) {
      .cmp-navigation .top-bar {
        z-index: auto; } }
    .cmp-navigation .top-bar::-webkit-scrollbar {
      width: 0 !important; }
    .cmp-navigation .top-bar input {
      height: auto;
      padding-bottom: 0.5rem;
      padding-top: 0.45rem; }
    .cmp-navigation .top-bar .cmp-inputiconed {
      margin-left: 1rem; }
    .cmp-navigation .top-bar .top-bar-left .cmp-navigation-homelink {
      padding: 0; }
    .cmp-navigation .top-bar .top-bar-right .cmp-navigation-userlink {
      padding-bottom: 0.5rem;
      padding-top: 0.5rem; }
  .cmp-navigation li.js-drilldown-back {
    display: none; }

.menu .cmp-navigation-actionbutton {
  margin: 0.5rem 0; }

.cmp-navigation-category {
  padding: 0 0.5rem 0.75rem; }

.cmp-navigation-badgealert {
  background-color: rgba(204, 75, 55, 0.25);
  border-radius: 2px;
  color: #cc4b37;
  display: inline-block;
  font-size: 0.875rem;
  padding: 0 0.25rem;
  margin: 0 0 0 -2rem;
  position: absolute;
  top: -0.125rem; }

.cmp-navigation-columntitle {
  font-weight: bold; }

.cmp-navigation-defaulticon {
  color: #757575;
  font-size: 1.25rem;
  margin-right: 0.75rem; }

@media only screen and (min-width: 960px) {
  .cmp-navigation-divider {
    display: inline-block; } }

@media only screen and (min-width: 960px) {
  .cmp-navigation-divider {
    position: relative; } }

@media only screen and (min-width: 960px) {
  .cmp-navigation-divider {
    top: 0.15rem; } }

@media only screen and (min-width: 960px) {
  .cmp-navigation-divider {
    -ms-transform: rotate(90deg);
        transform: rotate(90deg); } }

@media only screen and (min-width: 960px) {
  .cmp-navigation-divider {
    width: 1.5rem; } }

.cmp-navigation-dot {
  background-color: #e75635;
  border-radius: 50%;
  top: 0.625rem;
  height: 0.4rem;
  position: absolute;
  width: 0.4rem; }

.cmp-navigation-gridanchor {
  position: relative; }
  a.cmp-navigation-gridanchor {
    padding: 0; }

.cmp-navigation-gridcontent {
  margin-left: 2.5rem; }

.cmp-navigation-griddesctext {
  font-size: 0.875rem;
  color: #757575; }

.cmp-navigation-gridicon {
  object-fit: cover; }

.cmp-navigation-gridiconwrapper {
  height: 1.75rem;
  position: absolute;
  top: 1rem;
  width: 1.75rem; }

.cmp-navigation-highlightedsection {
  border: 1px solid #e3e3e3;
  text-align: left; }

li.cmp-navigation-leftsection {
  display: -ms-flexbox;
  display: flex; }
  @media only screen and (min-width: 960px) {
    li.cmp-navigation-leftsection {
      display: inline-block; } }

.cmp-navigation-link {
  position: relative; }
  .is-dropdown-submenu-parent .cmp-navigation-link {
    margin-right: 0.875rem; }

.cmp-navigation-logo {
  height: 2rem;
  margin: 0.25rem 0; }

.cmp-navigation-menu {
  z-index: 400; }
  @media only screen and (min-width: 960px) {
    .cmp-navigation-menu.medium-spaced {
      padding: 0.75rem; } }
  @media only screen and (min-width: 960px) {
    .cmp-navigation-menu.medium-spaced {
      width: 15rem; } }
  @media only screen and (min-width: 1280px) {
    .cmp-navigation-menu.medium-spaced {
      width: 24rem; } }
  @media only screen and (min-width: 960px) {
    .cmp-navigation-menu.large-spaced {
      padding: 0.75rem; } }
  @media only screen and (min-width: 960px) {
    .cmp-navigation-menu.large-spaced {
      width: 30rem; } }
  @media only screen and (min-width: 1280px) {
    .cmp-navigation-menu.large-spaced {
      width: 48rem; } }
  @media only screen and (min-width: 960px) {
    .cmp-navigation-menu {
      padding: 0.5rem; } }

.cmp-navigation-menubutton {
  padding: 0.75rem; }

.cmp-navigation-menucomment {
  display: block;
  padding-bottom: 0.5rem; }

.cmp-navigation-menuelement {
  position: relative;
  text-align: left; }
  .cmp-navigation-menuelement.inline {
    display: inline-block; }
    .dropdown .is-dropdown-submenu a.cmp-navigation-menuelement.inline {
      padding-left: 0.7rem;
      padding-right: 0.7rem; }
  .cmp-navigation-menuelement.venue {
    min-width: 15rem; }

.cmp-navigation-mobileclose {
  margin-left: auto; }

.cmp-navigation-mobilelogo {
  cursor: pointer;
  height: 2.25rem;
  padding: 0.125rem; }

.cmp-navigation-usericon, .cmp-navigation-userpicture {
  position: absolute;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%);
  height: 1.5rem;
  padding: 0.25rem 0;
  width: 1.5rem; }
  @media only screen and (min-width: 960px) {
    .cmp-navigation-usericon, .cmp-navigation-userpicture {
      position: relative; } }
  @media only screen and (min-width: 640px) {
    .cmp-navigation-usericon, .cmp-navigation-userpicture {
      top: 0; } }
  @media only screen and (min-width: 640px) {
    .cmp-navigation-usericon, .cmp-navigation-userpicture {
      -ms-transform: none;
          transform: none; } }

.cmp-navigation-usericon {
  border-radius: 50%;
  color: #fefefe;
  margin: 0 auto;
  text-align: center;
  background-color: #aaa; }
  .cmp-navigation-usericon:empty:after {
    content: "\f007";
    font-family: "FontAwesome"; }

.cmp-navigation-userpicture {
  background-color: #fefefe;
  background-position: center;
  background-repeat: no-repeat;
  background-size: cover;
  border-radius: 50%; }

.cmp-navigation-usersection {
  padding-left: 2.25rem; }

.cmp-navigation-venuebar {
  background-color: #e3e3e3;
  border-radius: 0.2rem;
  height: 0.4rem;
  margin-top: 0.4rem;
  margin-right: 3.5rem;
  position: relative; }

.cmp-navigation-venuefilled {
  background-color: #50aaeb;
  border-radius: 0.2rem;
  height: 0.4rem;
  position: absolute; }

.cmp-navigation-venueimage {
  background-repeat: no-repeat;
  background-position: center;
  background-size: cover;
  width: 100%;
  height: 2rem;
  position: absolute;
  right: 0.5rem;
  width: 3rem; }

.cmp-navigation-venuename {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap;
  padding-right: 3.5rem; }

.cmp-nag {
  bottom: 0;
  color: #fefefe;
  left: 0;
  position: fixed;
  right: 0;
  z-index: 500; }
  .cmp-nag.withsvg {
    background-color: #e75635;
    background-repeat: no-repeat;
    background-position: center center;
    background-attachment: scroll;
    background-size: cover; }

.cmp-nag-content {
  margin: 0 auto;
  max-width: 50rem;
  padding: 1.75rem 3rem 1.5rem; }
  .cmp-nag-content::after {
    clear: both; }
  .cmp-nag-content::after, .cmp-nag-content::before {
    content: ' ';
    display: table; }
  .cmp-nag-content.large {
    max-width: 75rem; }
  .cmp-nag-content.medium {
    padding: 0.75rem 3rem; }
  .cmp-nag-content.small {
    padding: 0.5rem 5rem; }
    @media only screen and (min-width: 640px) {
      .cmp-nag-content.small {
        display: inline-block; } }
  .cmp-nag-content.withbackground {
    background-color: #333; }

.cmp-nag-action {
  margin: 0.15rem; }
  .cmp-nag-action.lower {
    text-transform: none; }

.cmp-nag-comment {
  margin-bottom: 0.25rem; }

.cmp-nag-close {
  background-color: transparent;
  color: #fefefe;
  font-size: 0.875rem;
  padding: 0.35rem 0.65rem !important; }
  .cmp-nag-close:hover, .cmp-nag-close:focus {
    background-color: #757575;
    color: #fefefe; }

.cmp-nag-form {
  float: left;
  width: 50%; }
  .cmp-nag-form button {
    width: 30%; }
  .cmp-nag-form input {
    display: inline-block;
    padding: 0.65rem !important;
    margin-right: 5%;
    width: 60%; }

.cmp-nag-optout {
  margin-top: 0.5rem; }
  .cmp-nag-optout input[type=checkbox] + label {
    color: #fefefe;
    font-size: 0.875rem;
    padding-left: 1.25rem; }
  .cmp-nag-optout input[type=checkbox] + label:before {
    border: none;
    height: 0.75rem;
    top: 3px;
    width: 0.75rem; }
  .cmp-nag-optout input[type=checkbox]:checked + label:after {
    color: #757575;
    font-size: 10px;
    left: 0;
    top: 3px;
    width: 0.75rem; }

.cmp-nag-success {
  text-align: center; }

.cmp-nag-texts {
  float: left;
  width: 50%; }

.cmp-nag-toggle {
  color: #fefefe;
  cursor: pointer;
  height: 3rem;
  left: 0;
  padding-top: 0.5rem;
  position: absolute;
  text-align: center;
  top: 0rem;
  width: 3rem; }
  .cmp-nag-toggle i {
    font-family: futura, serif;
    font-size: 1.25rem; }

.cmp-ndaform {
  min-height: 22.5rem;
  text-align: center; }
  .cmp-ndaform .errorlist {
    margin-top: 0.5rem; }
  .cmp-ndaform .button.clear i {
    margin-left: 0.5rem; }
  .cmp-ndaform .button.clear.wait {
    cursor: wait; }

.cmp-ndaform-image {
  margin: 1.5rem auto 0;
  width: 60%; }

.cmp-ndaform-list {
  margin-left: 2rem;
  text-align: left; }
  .cmp-ndaform-list li {
    padding: 0.25rem; }

.cmp-ndaform-section {
  margin: 1rem;
  text-align: center; }
  .cmp-ndaform-section input {
    margin-bottom: 0;
    width: 50%; }

.cmp-ndaform-title {
  margin: 1.5rem 0; }

.cmp-newslettersignup-consentinput {
  display: inline-block;
  margin: 0.25rem 1.25rem 0 0; }

.cmp-newslettersignup-consenttext {
  margin-top: 0.75rem;
  margin-bottom: 0.25rem; }

.cmp-newslettersignup-errorwrapper {
  font-size: 0.875rem;
  color: #cc4b37; }

.cmp-newslettersignup-fieldwrapper {
  -ms-flex-align: end;
      align-items: flex-end; }
  .cmp-newslettersignup-fieldwrapper.extended {
    min-width: auto; }
    @media only screen and (min-width: 640px) {
      .cmp-newslettersignup-fieldwrapper.extended {
        min-width: 28rem; } }
  .cmp-newslettersignup-fieldwrapper input {
    background-color: inherit; }

.cmp-newslettersignup-submitbtn {
  margin-top: 1rem; }

.cmp-newslettersignup-submitbtnfooter {
  font-size: 0.75rem;
  background-color: #757575;
  padding: 0.25rem; }
  .cmp-newslettersignup-submitbtnfooter:hover {
    background-color: #292929; }

.cmp-newslettersignup-textcontainer {
  gap: 0.5rem; }

.cmp-newslettersignup-wrapper {
  gap: 1rem; }

.cmp-newslettersignup-modalwrapper {
  padding: 2rem;
  gap: 1rem; }

.cmp-nps-note {
  font-size: 0.65rem;
  padding-top: 0.25rem;
  text-transform: uppercase; }
  .cmp-nps-note.left {
    float: left; }
  .cmp-nps-note.right {
    float: right; }

.cmp-nps-form {
  margin: 0 auto;
  max-width: 32rem; }
  .cmp-nps-form input[type=radio] + label {
    background-color: #f7f7f7;
    border-radius: 2px;
    color: #757575;
    font-size: 0.875rem;
    line-height: 1.2;
    padding: 0.8rem;
    text-align: center;
    width: 100%; }
  .cmp-nps-form input[type=radio] + label::before {
    border: none;
    background-color: transparent; }
  .cmp-nps-form input[type=radio] + label:hover {
    background-color: #ddd; }
  .cmp-nps-form input[type=radio]:checked + label {
    background-color: #aaa;
    color: #fefefe; }
  .cmp-nps-form input[type=radio]:checked + label:after {
    content: ""; }
  .cmp-nps-form::after {
    clear: both; }
  .cmp-nps-form::after, .cmp-nps-form::before {
    content: ' ';
    display: table; }
  .cmp-nps-form textarea {
    border-bottom: 1px solid #fefefe;
    float: left;
    font-size: 0.875rem;
    height: 2.6rem;
    margin-bottom: 0.825rem;
    min-height: 2.6rem;
    width: 27rem; }
    .cmp-nps-form textarea:focus {
      border-bottom: 2px solid #fefefe; }
    .cmp-nps-form textarea:-ms-input-placeholder {
      color: #fefefe;
      opacity: 0.35; }
    .cmp-nps-form textarea::placeholder {
      color: #fefefe;
      opacity: 0.35; }
  .cmp-nps-form .button {
    float: left;
    margin-left: 1rem;
    width: 4rem; }
  .cmp-nps-form .row {
    margin: 0 -0.25rem; }
    .cmp-nps-form .row .column, .cmp-nps-form .row .columns {
      padding: 0 0.25rem; }

.cmp-nps-title {
  margin-bottom: 0.75rem;
  text-align: center; }

.cmp-numberwidget-buttonwrapper {
  border: 1px solid #e3e3e3;
  height: 2.25rem;
  width: 2.25rem;
  border-radius: 50%;
  border: 1px solid #e3e3e3;
  background-color: white;
  z-index: 100;
  position: relative;
  -ms-flex-align: center;
      align-items: center;
  -ms-flex-pack: center;
      justify-content: center;
  margin-top: -0.25rem; }
  .cmp-numberwidget-buttonwrapper i {
    margin: 0; }

.cmp-numberwidget-wrapper {
  min-width: 4.25rem;
  -ms-flex-pack: distribute;
      justify-content: space-around;
  border-radius: 5rem;
  padding: 0.15rem 0rem;
  border: 1px solid #e3e3e3;
  border: 1px solid #e3e3e3;
  -ms-flex-wrap: nowrap;
      flex-wrap: nowrap;
  height: 2.25rem; }
  .cmp-numberwidget-wrapper .cmp-numberwidget-button {
    padding: 0; }
    .cmp-numberwidget-wrapper .cmp-numberwidget-button.left {
      margin-left: -0.25rem; }
    .cmp-numberwidget-wrapper .cmp-numberwidget-button.right {
      margin-left: 0.25rem; }

.cmp-numberwidget-numberinputcontainer {
  width: 100%;
  -ms-flex-pack: center;
      justify-content: center; }

.cmp-numberwidget-icon {
  font-size: 1.2rem; }

.cmp-numberwidget-input {
  border: 0; }
  .cmp-numberwidget-input:focus {
    border: 0; }

.cmp-openinghoursform-actions {
  margin-top: 1.25rem; }

.cmp-openinghoursform-comment {
  margin-bottom: 1.5rem; }

.cmp-openinghoursform-copy {
  display: inline-block;
  margin: 0.5rem 0.375rem 1rem; }

.cmp-openinghoursform-label {
  margin-top: 0.875rem; }

.cmp-orgform-list {
  padding: 1rem 0; }
  .cmp-orgform-list li {
    margin-bottom: 0.25rem; }

.cmp-orgform-planwrapper {
  padding: 1.5rem;
  gap: 1rem;
  margin-bottom: 1rem; }
  .cmp-orgform-planwrapper .cmp-orgform-plandisplaylabel {
    color: #757575;
    font-size: 0.875rem; }

.cmp-orgform-section {
  margin-bottom: 2rem; }
  @media only screen and (min-width: 640px) {
    .cmp-orgform-section {
      margin-bottom: 4rem; } }

.cmp-orgform-title {
  margin-bottom: 0.75rem; }

.cmp-orgformpremiumbanner-herotext {
  margin-top: 0; }

.cmp-orgformpremiumbanner-textcontainer {
  row-gap: 1.5em; }

.cmp-orgformpremiumbanner-wrapper {
  background-color: #f7f7f7;
  padding: 1.5rem;
  -ms-flex-wrap: nowrap;
      flex-wrap: nowrap;
  column-gap: 2.5rem;
  margin-top: 2rem;
  margin-bottom: 1rem; }
  .cmp-orgformpremiumbanner-wrapper i {
    font-size: 2.5rem; }
  .cmp-orgformpremiumbanner-wrapper a {
    max-width: 12rem; }

.cmp-orgpreferredspacestoggle-switch {
  display: inline-block;
  margin-left: 0.75rem; }

.cmp-orgpreferredspacestoggle-wrapper {
  background-color: #f7f7f7;
  margin-bottom: 4rem;
  padding: 2rem; }

.cmp-orgrow.row {
  border-bottom: 1px solid #ccc; }
  .cmp-orgrow.row:last-child {
    border-bottom: none; }
  .cmp-orgrow.row > .column, .cmp-orgrow.row > .columns {
    padding-top: 1rem;
    padding-bottom: 1rem;
    position: relative; }

.cmp-orgrow-org {
  position: relative; }

.cmp-orgrow-orgicon, .cmp-orgrow-orgpicture {
  font-size: 1.25rem;
  height: 2.4rem;
  padding: 0.3rem 0;
  position: absolute;
  top: 0;
  width: 2.4rem; }

.cmp-orgrow-orgicon {
  border-radius: 50%;
  color: #fefefe;
  margin: 0 auto;
  text-align: center; }
  .cmp-orgrow-orgicon:empty:after {
    content: "\f007";
    font-family: "FontAwesome"; }

.cmp-orgrow-orgpicture {
  background-color: #fefefe;
  background-position: center;
  background-repeat: no-repeat;
  background-size: cover;
  border-radius: 50%; }

@media only screen and (min-width: 640px) {
  .cmp-orgrow-org ~ .cmp-orgrow-text {
    margin-left: 3rem; } }

.cmp-orgrow-link {
  font-size: 0.875rem;
  padding: 0 0.25rem; }

.cmp-orgrow-price {
  padding-left: 0.25rem; }

.cmp-orgrow-text {
  font-size: 0.875rem; }
  .cmp-orgrow-text:not(.untrimmed) {
    overflow: hidden;
    text-overflow: ellipsis;
    white-space: nowrap; }
  .cmp-orgrow-text.gray {
    color: #757575; }
  .cmp-orgrow-text + .cmp-orgrow-text {
    margin-top: 0.1rem; }

.cmp-orgupsellinglink {
  background-color: #f7f1ff;
  margin-top: 1rem;
  padding: 0.5rem 0.75rem; }
  @media only screen and (min-width: 640px) {
    .cmp-orgupsellinglink {
      padding: 0.75rem 1.125rem; } }

.cmp-orgupsellingprice {
  margin-top: 1rem; }

.cmp-orgupsellingprice-icon {
  color: #b87af5;
  position: relative;
  top: 0.25rem;
  -ms-transform: rotate(180deg);
      transform: rotate(180deg); }

.cmp-orgfeature-title {
  margin-bottom: 0.5rem; }
  @media only screen and (min-width: 960px) {
    .cmp-orgfeature-title {
      margin-bottom: 0.75rem; } }

.cmp-orgfeature-wrapper {
  margin-bottom: 1rem; }
  @media only screen and (min-width: 960px) {
    .cmp-orgfeature-wrapper {
      margin-bottom: 0; } }

.cmp-packagefeature {
  padding: 0 0.75rem;
  position: relative; }

.cmp-packagefeature-element {
  margin-bottom: 0.75rem;
  margin-left: 2rem; }
  .cmp-packagefeature-element.disabled {
    color: #aaa; }

.cmp-packagefeature-image {
  height: 2rem;
  margin-bottom: 0.75rem;
  margin-left: 1.75rem;
  position: relative;
  top: -0.25rem; }
  .cmp-packagefeature-image.disabled {
    opacity: 0.5; }

.cmp-packagefeature-icon {
  margin-right: 0.5rem; }

.cmp-packageoption {
  border-radius: 0.75rem;
  padding: 2rem;
  position: relative; }
  .cmp-packageoption.selected {
    background-color: #aaa;
    color: #fefefe; }

.cmp-packageoption-advantageswrapper {
  gap: 0.5rem;
  margin-top: 2rem;
  padding-left: 2rem; }

.cmp-packageoption-annual {
  text-align: right; }

.cmp-packageoption-button {
  margin-top: 2rem;
  width: 100%; }

.cmp-packageoption-commission {
  margin-top: 0.5rem;
  text-align: right; }

.cmp-packageoption-description {
  margin-top: 1rem; }

.cmp-packageoption-highlight {
  left: 0;
  position: absolute;
  right: 0;
  text-align: center;
  top: -2rem; }

.cmp-packageoption-name {
  font-size: 1.5rem; }

.cmp-packageoption-plancontentwrapper {
  -ms-flex-pack: justify;
      justify-content: space-between;
  height: 100%; }

.cmp-packageoption-price {
  margin-top: 1rem; }

.cmp-packageoption-taxes {
  text-align: right; }

.cmp-packageoption-type {
  margin-bottom: 2rem; }

.cmp-packageoption-wrapper {
  padding-top: 2rem; }

.cmp-pageoverlay {
  background-color: rgba(254, 254, 254, 0.85);
  bottom: 0;
  left: 0;
  overflow-y: auto;
  position: fixed;
  right: 0;
  top: 0;
  z-index: 700; }

.cmp-pageback-container.spacedbottom {
  margin-bottom: 2rem; }

.cmp-pageback-icon {
  position: relative;
  top: 0.1rem; }
  .cmp-pageback-icon.material-icons {
    font-size: 0.875rem; }

.cmp-pageback-wrapper {
  -ms-flex-align: center;
      align-items: center; }

.cmp-pagination {
  margin-top: 1rem;
  text-align: center; }

.cmp-pagination-current {
  padding: 0 0.5rem;
  position: relative;
  top: 0.1rem; }

.cmp-paymentmethods-grid.row {
  margin-right: -0.5rem;
  margin-left: -0.5rem; }

.cmp-paymentmethods-grid .column, .cmp-paymentmethods-grid .columns {
  padding: 0.15rem 0.5rem; }

.cmp-paymentmethods-helptext {
  padding-top: 1rem; }

.cmp-paymentmethods-note {
  color: #aaa;
  font-size: 0.875rem;
  padding-top: 0.1rem; }
  .cmp-paymentmethods-note a {
    font-size: 0.875rem; }

.cmp-paymentmethods-radio {
  background-color: #eee;
  border-radius: 2px;
  padding: 0.75rem 0 0.75rem 0.875rem; }
  .cmp-paymentmethods-radio input:disabled + label {
    opacity: 0.5; }

.cmp-paymentmethods-title {
  margin-bottom: 0.2rem; }

.cmp-paymentusp-card {
  padding: 0.25rem; }

.cmp-paymentusp-image {
  height: 2rem;
  max-width: 3rem; }
  .cmp-paymentusp-image.small {
    height: 1rem;
    max-width: 2rem; }
    @media only screen and (min-width: 960px) {
      .cmp-paymentusp-image.small {
        height: 1.5rem; } }

.cmp-paypal {
  position: relative; }

.cmp-paypal-iframe.disabled {
  opacity: 0.25; }

.cmp-paypal-error {
  color: #cc4b37;
  margin-bottom: 0.25rem; }

.cmp-paypal-label {
  margin-bottom: 0.25rem; }

.cmp-paypal-overlay.disabled {
  bottom: 0;
  cursor: not-allowed;
  height: 35px;
  position: absolute;
  width: 250px;
  z-index: 700; }

.cmp-chip {
  border: 1px solid #e3e3e3;
  border-radius: 1rem;
  display: inline-block;
  font-size: 0.875rem;
  padding: 0.2rem 0.5rem;
  text-decoration: none; }
  .cmp-chip:hover {
    background-color: #e3e3e3; }
  .cmp-chip.hollow {
    background-color: transparent;
    border: 1px solid #ddd; }
  .cmp-chip.interactable {
    cursor: pointer; }

.cmp-chip-closeicon {
  margin-left: 0.2rem; }

.cmp-chipscontainer:not(:empty) {
  margin-top: 0.75rem; }

.cmp-chipsrecap-container {
  margin: 1rem 0;
  column-gap: 0.75rem;
  row-gap: 0.75rem; }

.cmp-chipsrecap-icon {
  height: 1.25rem;
  object-fit: cover;
  object-position: top;
  padding-right: 0.125rem;
  width: 1.25rem; }

.cmp-chipsrecap-item {
  border: 1px solid #e3e3e3;
  border-radius: 1rem;
  display: inline-block;
  font-size: 0.875rem;
  padding: 0.2rem 0.5rem;
  text-decoration: none;
  background-color: #e3e3e3;
  gap: 0.2rem;
  margin: 0;
  -ms-flex-wrap: nowrap;
      flex-wrap: nowrap;
  -ms-flex-align: center;
      align-items: center;
  color: #333;
  cursor: auto;
  height: 2rem; }
  .cmp-chipsrecap-item:hover {
    background-color: #e3e3e3; }
  .cmp-chipsrecap-item.hollow {
    background-color: transparent;
    border: 1px solid #ddd; }
  .cmp-chipsrecap-item.interactable {
    cursor: pointer; }

.cmp-chipsrecap-price {
  text-transform: uppercase; }
  .cmp-chipsrecap-price.primary {
    font-size: 0.875rem; }

.cmp-chipsrecap-wrapper {
  -ms-flex-wrap: nowrap;
      flex-wrap: nowrap;
  margin-top: 0.5rem; }

.cmp-placephotogrid-tile {
  padding-bottom: 66.66%; }
  .cmp-placephotogrid-tile .cmp-placephotogrid-tilecontrolled {
    opacity: 0.5; }
  .cmp-placephotogrid-tile .cmp-placephotogrid-tilecontrol {
    background-clip: content-box;
    background-position: top center;
    background-repeat: no-repeat;
    height: 90px;
    left: 50%;
    opacity: 0.5;
    position: absolute;
    top: 50%;
    -ms-transform: translate(-50%, -50%);
        transform: translate(-50%, -50%);
    width: 126px; }
  .cmp-placephotogrid-tile .cmp-placephotogrid-tile:hover .cmp-placephotogrid-tilecontrol {
    background-position: bottom center;
    opacity: 1; }

.cmp-placephotogrid-tile {
  position: relative; }

.cmp-placephotogrid-tileimage {
  height: 100%;
  object-fit: cover;
  position: absolute;
  width: 100%; }

.cmp-placeintro {
  margin-bottom: 1.5rem;
  margin-top: 0.5rem; }
  @media only screen and (min-width: 1280px) {
    .cmp-placeintro {
      margin-bottom: 2.5rem; } }

@media only screen and (min-width: 640px) {
  .cmp-placeintro-content.bottom {
    padding-top: 2rem; } }

.cmp-placeintro-icon {
  margin: 0;
  margin-right: 0.5rem; }

.cmp-placeintro-placenamewrapper {
  -ms-flex-align: center;
      align-items: center;
  -ms-flex-wrap: nowrap;
      flex-wrap: nowrap; }
  .cmp-placeintro-placenamewrapper a {
    margin-bottom: -0.25rem; }

.cmp-placeintro-image {
  background-color: #e3e3e3; }
  .cmp-placeintro-image img {
    object-fit: cover;
    height: 100%;
    aspect-ratio: 2/1; }

.cmp-placeintro-infowrapper {
  -ms-flex-align: center;
      align-items: center; }

.cmp-placeintro-labelspace {
  background-color: #fefefe;
  border-radius: 2px;
  border: 1px solid #50aaeb;
  color: #50aaeb;
  display: inline-block;
  font-size: 0.875rem;
  padding: 0.1rem 0.5rem;
  margin: 0 0.5rem 0 0;
  text-transform: uppercase; }

.cmp-placeintro-labelvenue {
  background-color: #50aaeb;
  border-radius: 2px;
  color: #fefefe;
  display: inline-block;
  font-size: 0.875rem;
  padding: 0.1rem 0.5rem;
  margin: 0 0.5rem 0 0;
  text-transform: uppercase; }

.cmp-placeintro-labelspace, .cmp-placeintro-labelvenue {
  margin-left: 1.5rem;
  margin-right: 0.5rem; }

.cmp-placeintro-subtitle {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap; }

.cmp-placeintro-title {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap; }

.cmp-placepricing-comment {
  margin-bottom: 0.25rem;
  margin-top: 1rem; }

.cmp-placepricing-detail {
  margin-top: 0.35rem; }

.cmp-placepricing-grid.row {
  margin-left: -0.25rem;
  margin-right: -0.25rem; }
  .cmp-placepricing-grid.row .column, .cmp-placepricing-grid.row .columns {
    padding: 0.25rem; }

.cmp-placepricing-label {
  margin-left: 2.75rem; }

.cmp-placeintro-linkicon {
  color: #50aaeb; }

.cmp-placepricing-stack {
  position: relative; }
  .cmp-placepricing-stack img {
    height: 2.1rem;
    left: 0;
    opacity: 0.35;
    position: absolute;
    top: 0.2rem;
    width: 2.1rem; }

.cmp-placepricing-value {
  margin-left: 2.75rem; }

.cmp-placerowelement {
  border-top: 1px solid #e3e3e3;
  padding: 1.5rem 2rem;
  position: relative; }
  @media only screen and (min-width: 640px) {
    .cmp-placerowelement {
      min-height: 10.5rem; } }

.cmp-placerowelement-buttons {
  padding-top: 1rem; }
  @media only screen and (min-width: 640px) {
    .cmp-placerowelement-buttons {
      padding-top: 0; } }
  @media only screen and (min-width: 640px) {
    .cmp-placerowelement-buttons {
      position: absolute; } }
  @media only screen and (min-width: 640px) {
    .cmp-placerowelement-buttons {
      right: 2rem; } }
  @media only screen and (min-width: 640px) {
    .cmp-placerowelement-buttons {
      text-align: right; } }
  @media only screen and (min-width: 640px) {
    .cmp-placerowelement-buttons {
      top: 50%; } }
  @media only screen and (min-width: 640px) {
    .cmp-placerowelement-buttons {
      -ms-transform: translateY(-50%);
          transform: translateY(-50%); } }
  @media only screen and (min-width: 640px) {
    .cmp-placerowelement-buttons {
      width: 10rem; } }
  @media only screen and (min-width: 960px) {
    .cmp-placerowelement-buttons {
      width: 16rem; } }

@media only screen and (min-width: 640px) {
  .cmp-placerowelement-content {
    left: 14rem; } }

@media only screen and (min-width: 640px) {
  .cmp-placerowelement-content {
    position: absolute; } }

@media only screen and (min-width: 640px) {
  .cmp-placerowelement-content {
    right: 12rem; } }

@media only screen and (min-width: 960px) {
  .cmp-placerowelement-content {
    right: 18rem; } }

@media only screen and (min-width: 640px) {
  .cmp-placerowelement-content {
    top: 50%; } }

@media only screen and (min-width: 640px) {
  .cmp-placerowelement-content {
    -ms-transform: translateY(-50%);
        transform: translateY(-50%); } }

.cmp-placerowelement-form {
  gap: 2rem; }
  .cmp-placerowelement-form .switch-text {
    margin-left: 0; }

.cmp-placerowelement-id {
  color: #757575;
  margin-left: 0.5rem;
  margin-right: 0.25rem; }

.cmp-placerowelement-image {
  background-repeat: no-repeat;
  background-position: center;
  background-size: cover;
  width: 100%;
  background-color: #e3e3e3;
  display: none;
  height: 7.5rem;
  width: 10rem; }
  @media only screen and (min-width: 640px) {
    .cmp-placerowelement-image {
      display: block; } }
  @media only screen and (min-width: 640px) {
    .cmp-placerowelement-image {
      position: absolute; } }

.cmp-placerowelement-label {
  background-color: #fefefe;
  border-radius: 2px;
  border: 1px solid #cc4b37;
  color: #cc4b37;
  display: inline-block;
  font-size: 0.875rem;
  padding: 0.2rem 0.4rem 0.1rem;
  margin: 0 0.5rem 0 0;
  text-transform: uppercase; }

.cmp-placerowelement-label {
  position: relative; }

.cmp-placerowelement-main {
  position: relative; }

.cmp-placerowelement-status {
  color: #50aaeb; }

.cmp-placerowelement-svg {
  background-position: center center;
  background-repeat: no-repeat;
  padding-top: 75%; }

.cmp-placerowelement-title {
  margin-bottom: 0.5rem;
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap; }
  .cmp-placerowelement-title.gray {
    color: #aaa; }

.cmp-placerowelement-valuelabel {
  color: #757575;
  font-size: 0.875rem; }

.cmp-placerowgroup {
  padding: 2.5rem 0 1rem;
  position: relative; }
  .cmp-placerowgroup i {
    color: #757575; }

.cmp-placerowgroup-buttons {
  padding-top: 1rem; }
  @media only screen and (min-width: 640px) {
    .cmp-placerowgroup-buttons {
      padding-top: 0; } }
  @media only screen and (min-width: 640px) {
    .cmp-placerowgroup-buttons {
      position: absolute; } }
  @media only screen and (min-width: 640px) {
    .cmp-placerowgroup-buttons {
      top: 50%; } }
  @media only screen and (min-width: 640px) {
    .cmp-placerowgroup-buttons {
      -ms-transform: translateY(-50%);
          transform: translateY(-50%); } }
  @media only screen and (min-width: 640px) {
    .cmp-placerowgroup-buttons {
      width: 16rem; } }
  @media only screen and (min-width: 960px) {
    .cmp-placerowgroup-buttons {
      width: 24rem; } }

@media only screen and (min-width: 640px) {
  .cmp-placerowgroup-content {
    padding-right: 24rem; } }

.cmp-placerowgroup-id {
  color: #757575;
  margin-left: 0.5rem; }

.cmp-placerowgroup-item {
  display: inline-block;
  margin: 0 0.625rem 1rem;
  vertical-align: top;
  width: 20rem; }

.cmp-placerowgroup-label {
  background-color: #cc4b37;
  border-radius: 2px;
  color: #fefefe;
  display: inline-block;
  font-size: 0.875rem;
  padding: 0.2rem 0.4rem 0.1rem;
  margin: 0 0.5rem 0 0;
  text-transform: uppercase; }

.cmp-placerowgroup-label {
  position: relative;
  top: -0.2rem; }

.cmp-placerowgroup-status {
  color: #50aaeb;
  margin-top: 0.5rem; }

.cmp-placerowgroup-value {
  margin-top: 0.375rem; }

.cmp-placerowgroup-valueicon {
  vertical-align: middle; }

.cmp-placerowgroup-valuelabel {
  color: #757575;
  font-size: 0.875rem; }

.cmp-placeusp-content {
  margin-left: 3rem; }
  .cmp-placeusp-content.extended {
    margin-left: 9rem; }

.cmp-placeusp-highlights::first-letter {
  text-transform: uppercase; }

.cmp-placeusp-icon {
  left: 0.25rem;
  position: absolute;
  top: 0.5rem;
  width: 1.75rem; }
  .cmp-placeusp-icon.extended {
    width: 7.5rem; }

.cmp-placeusp-title {
  margin-bottom: 0.125rem; }

.cmp-placeusp-wrapper {
  position: relative;
  margin-bottom: 0.75rem; }
  .cmp-placeusp-wrapper:nth-of-type(n + 4) {
    display: none; }

.cmp-prosection-comment {
  color: #757575;
  margin-top: 0.375rem; }

.cmp-prosection-title {
  margin-bottom: 0.75rem; }

.cmp-prosection-wrapper {
  background-color: rgba(255, 174, 0, 0.1);
  margin-bottom: 0.75rem;
  margin-top: 1.5rem;
  padding: 0.75rem 1.25rem; }

.cmp-protag {
  background-color: #ffae00;
  border-radius: 2px;
  color: #fefefe;
  display: inline-block;
  font-size: 0.875rem;
  font-weight: bold;
  padding: 0.15rem 0.5rem;
  margin: 0.1rem;
  text-transform: uppercase; }

.cmp-providerenquirymodal-container li {
  margin: 0.2rem 0px; }

.cmp-providerenquirymodal-illustration {
  width: 11rem;
  margin-left: 1rem;
  margin-top: 1rem; }

.cmp-providerenquirymodal-button {
  margin-right: 1rem; }

.cmp-providerenquirymodal-buttonsecondary {
  padding-left: 0; }

.cmp-providerenquirymodal-buttonswrapper {
  -ms-flex-pack: start;
      justify-content: start;
  margin-top: 0.25rem; }

.cmp-providerenquirymodal-maintext {
  margin: 0.5rem 0px; }

.cmp-providerenquirymodal-renterdetailsblurredwrapper {
  filter: blur(0.125rem);
  margin-top: 0.25rem; }

.cmp-providerenquirymodal-renterdetailswrapper {
  margin-top: 1.5rem; }

.cmp-providerenquirymodal-secondarytext {
  margin-top: 1.5rem;
  margin-bottom: 0.25rem; }

.cmp-priceperson {
  background-color: rgba(254, 254, 254, 0.85);
  border-radius: 2px;
  color: #333;
  margin: 1.6rem 0 0.8rem 1.6rem;
  padding: 0.5rem 0.75rem 0.5rem 1.6rem;
  position: relative; }

.cmp-priceperson-comment {
  color: #757575;
  font-size: 0.875rem; }

.cmp-priceperson-image {
  height: 2.4rem;
  left: -1.2rem;
  position: absolute;
  top: -0.8rem;
  width: 2.4rem; }

.cmp-pricingbreakdown {
  background: transparent;
  border: none;
  text-align: right;
  width: 100%; }
  .cmp-pricingbreakdown td {
    border: none;
    padding: 0.175rem 0; }
  .cmp-pricingbreakdown td:first-child {
    text-align: left; }

.cmp-pricingbreakdown-divider {
  padding: 0.175rem 0; }

.cmp-pricingbreakdown-extracomment {
  margin-bottom: 1.5rem; }

.cmp-pricingbreakdown-explanation td {
  color: #757575;
  font-size: 0.875rem;
  text-transform: uppercase; }

.cmp-pricingbreakdown-gray td {
  color: #757575; }

.cmp-pricingbreakdown-icon {
  background-size: 100%;
  display: inline-block;
  height: 0.875rem;
  left: 0.05rem;
  margin-right: 0.15rem;
  position: relative;
  top: 0.2rem;
  width: 0.875rem; }

.cmp-pricingbreakdown-units {
  color: #757575;
  font-size: 0.875rem; }

.cmp-pricingplace-text {
  margin-top: 0.25rem; }
  .cmp-pricingplace-text.small {
    font-size: 0.875rem; }

.cmp-pricingplace-title {
  font-size: 0.875rem;
  margin-bottom: 0.5rem;
  text-transform: uppercase; }

input[type=radio].cmp-radioselectbar + label {
  border-bottom: 3px solid transparent;
  font-size: 1rem;
  margin: 0.5rem 0.5rem 0.125rem;
  padding: 0 0.25rem 0.25rem; }
  input[type=radio].cmp-radioselectbar + label:hover {
    border-bottom: 3px solid #757575; }

input[type=radio].cmp-radioselectbar + label:after {
  display: none; }

input[type=radio].cmp-radioselectbar + label:before {
  display: none; }

input[type=radio].cmp-radioselectbar:checked + label {
  border-bottom: 3px solid #333; }

.cmp-readonlywidget {
  margin-top: 0.25rem; }

.cmp-rentalelement-address {
  position: relative; }

.cmp-rentalelement-contents {
  padding: 0.5rem 0rem;
  -ms-flex-pack: justify;
      justify-content: space-between; }
  @media only screen and (min-width: 640px) {
    .cmp-rentalelement-contents {
      margin-left: 50%; } }
  @media only screen and (min-width: 640px) {
    .cmp-rentalelement-contents {
      min-height: 12rem; } }
  @media only screen and (min-width: 640px) {
    .cmp-rentalelement-contents {
      padding: 0rem 0.75rem; } }
  .cmp-rentalelement-contents.small {
    min-height: 6rem; }
    @media only screen and (min-width: 640px) {
      .cmp-rentalelement-contents.small {
        min-height: auto; } }
    @media only screen and (min-width: 640px) {
      .cmp-rentalelement-contents.small {
        margin-left: 20%; } }

.cmp-rentalelement-herospace {
  height: 1rem;
  margin-left: 0.25rem;
  position: relative;
  top: -0.1rem; }

.cmp-rentalelement-icon {
  font-size: 1.25rem;
  position: absolute; }
  .cmp-rentalelement-icon.fa-map-marker {
    padding-left: 0.2rem; }

.cmp-rentalelement-image, .cmp-rentalelement-map {
  height: 12rem;
  position: relative;
  width: 100%; }
  @media only screen and (min-width: 640px) {
    .cmp-rentalelement-image, .cmp-rentalelement-map {
      bottom: 0; } }
  @media only screen and (min-width: 640px) {
    .cmp-rentalelement-image, .cmp-rentalelement-map {
      height: auto; } }
  @media only screen and (min-width: 640px) {
    .cmp-rentalelement-image, .cmp-rentalelement-map {
      left: 0; } }
  @media only screen and (min-width: 640px) {
    .cmp-rentalelement-image, .cmp-rentalelement-map {
      position: absolute; } }
  @media only screen and (min-width: 640px) {
    .cmp-rentalelement-image, .cmp-rentalelement-map {
      right: 50%; } }
  @media only screen and (min-width: 640px) {
    .cmp-rentalelement-image, .cmp-rentalelement-map {
      top: 0; } }
  @media only screen and (min-width: 640px) {
    .cmp-rentalelement-image, .cmp-rentalelement-map {
      width: auto; } }

.cmp-rentalelement-image {
  background-clip: content-box;
  background-position: center center;
  background-repeat: no-repeat;
  background-size: cover; }
  .cmp-rentalelement-image.small {
    height: 6rem; }
    @media only screen and (min-width: 640px) {
      .cmp-rentalelement-image.small {
        height: auto; } }
    @media only screen and (min-width: 640px) {
      .cmp-rentalelement-image.small {
        right: 80%; } }

.cmp-rentalelement-link {
  margin-top: 1rem; }

.cmp-rentalelement-spacescomment {
  margin-top: 1.5rem;
  margin-bottom: 0.25rem; }

.cmp-rentalelement-subtitle {
  display: inline-block; }

.cmp-rentalelement-text {
  margin-left: 2rem; }
  .cmp-rentalelement-text + .cmp-rentalelement-text {
    margin-top: 0.25rem; }

.cmp-rentalelement-title {
  margin-bottom: 0.5rem; }
  @media only screen and (min-width: 640px) {
    .cmp-rentalelement-title {
      margin-bottom: 0.75rem; } }
  .cmp-rentalelement-title i {
    font-size: 0.875rem;
    margin-left: 0.25rem; }

.cmp-rentalelement-wrapper {
  position: relative; }

.cmp-requesteditemdetail {
  position: relative; }

.cmp-requesteditemdetail-comment {
  color: #757575;
  font-size: 0.875rem; }

.cmp-requesteditemdetail-content {
  margin-left: 2.5rem; }
  .cmp-requesteditemdetail-content.padded {
    margin-left: 5rem; }

.cmp-requesteditemdetail-icon {
  background-size: 100%;
  height: 1.75rem;
  position: absolute;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%);
  width: 1.75rem; }

.cmp-requesteditemdetail-image {
  background-size: 100%;
  height: 3.5rem;
  position: absolute;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%);
  width: 4.75rem; }

.cmp-requesteditemdetail-title {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap; }
  .cmp-requesteditemdetail-title::first-letter {
    text-transform: uppercase; }

.cmp-requesteditemdetail {
  padding-bottom: 0.5rem;
  padding-top: 0.5rem; }

.cmp-requesteditemdetail-actionstatusiconswrapper i {
  cursor: pointer;
  margin-right: 0;
  margin-left: 0.2rem; }

.cmp-requesteditemdetail-actionstatusiconswrapper .cmp-requesteditemdetail-actionstatusspacing {
  display: none;
  margin: 0 0.25rem; }
  @media only screen and (min-width: 640px) {
    .cmp-requesteditemdetail-actionstatusiconswrapper .cmp-requesteditemdetail-actionstatusspacing {
      display: inline-block; } }

.cmp-requesteditemdetail-activeicon {
  font-size: 0.6rem;
  position: absolute;
  border: 3px solid #fefefe;
  top: -0.5rem;
  right: -0.25rem;
  margin: 0; }

.cmp-requesteditemdetail-commentwrapper {
  padding-right: 0.5rem;
  -ms-flex-wrap: nowrap;
      flex-wrap: nowrap;
  -ms-flex-align: center;
      align-items: center; }
  @media only screen and (min-width: 640px) {
    .cmp-requesteditemdetail-commentwrapper {
      padding-right: 1.5rem; } }

.cmp-requesteditemdetail-shortdescription {
  font-size: 0.875rem; }
  .cmp-requesteditemdetail-shortdescription.trimmed {
    overflow: hidden;
    text-overflow: ellipsis;
    display: block;
    white-space: nowrap; }

.cmp-requesteditemdetail-fixedpriceanchor {
  color: inherit; }

.cmp-requesteditemdetail-fixedpriceicon {
  font-size: 0.875rem; }

.cmp-requesteditemdetail-fixedpricewarningicon {
  color: #ffae00;
  font-size: 1.2rem;
  margin-top: 0.2rem; }

.cmp-requesteditemdetail-infoicon {
  font-size: 0.875rem;
  color: #757575; }

.cmp-requesteditemdetail-loadingicon {
  font-size: 0.875rem; }

.cmp-requesteditemdetail-number {
  position: relative;
  width: 8rem; }
  .cmp-requesteditemdetail-number input {
    height: auto;
    padding: 0;
    padding-left: 0.25rem;
    margin: 0;
    text-align: center;
    width: 100%; }
  .cmp-requesteditemdetail-number input[type=number]::-webkit-inner-spin-button, .cmp-requesteditemdetail-number input[type=number]::-webkit-outer-spin-button {
    -webkit-appearance: none;
    -moz-appearance: none;
    appearance: none; }

.cmp-requesteditemdetail-title {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap; }

.cmp-requesteditemdetail-titlewrapper {
  display: -ms-flexbox;
  display: flex;
  -ms-flex-direction: column;
      flex-direction: column; }
  @media only screen and (min-width: 640px) {
    .cmp-requesteditemdetail-titlewrapper {
      -ms-flex-direction: row;
          flex-direction: row; } }

.cmp-requesteditemdetail-unitsicon {
  color: #757575; }

.cmp-requesteditemedit {
  position: relative; }

.cmp-requesteditemedit-comment {
  color: #757575;
  font-size: 0.875rem; }

.cmp-requesteditemedit-content {
  margin-left: 2.5rem; }
  .cmp-requesteditemedit-content.padded {
    margin-left: 5rem; }

.cmp-requesteditemedit-icon {
  background-size: 100%;
  height: 1.75rem;
  position: absolute;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%);
  width: 1.75rem; }

.cmp-requesteditemedit-image {
  background-size: 100%;
  height: 3.5rem;
  position: absolute;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%);
  width: 4.75rem; }

.cmp-requesteditemedit-title {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap; }
  .cmp-requesteditemedit-title::first-letter {
    text-transform: uppercase; }

.cmp-requesteditemedit.disabled {
  opacity: 0.5; }

.cmp-requesteditemedit-action {
  padding-left: 0.5rem; }

.cmp-requesteditemedit-grid {
  margin: 0.125rem 0 0.25rem; }

.cmp-requesteditemedit-link {
  color: #333; }
  .cmp-requesteditemedit-link:hover {
    color: #50aaeb; }
    .cmp-requesteditemedit-link:hover .cmp-requesteditemedit-comment {
      color: #50aaeb; }

.cmp-requesteditemedit-title {
  margin-bottom: 0.125rem; }
  .cmp-requesteditemedit-title.available, .cmp-requesteditemedit-title.mandatory {
    color: #50aaeb; }

.cmp-requesteditemfieldset-details {
  position: relative;
  margin-bottom: 0.25rem; }

.cmp-requesteditemfieldset-description {
  font-size: 0.875rem; }

.cmp-requesteditemfieldset-image {
  position: absolute;
  top: 0.3rem;
  width: 6rem; }
  .cmp-requesteditemfieldset-image + .cmp-requesteditemfieldset-description {
    margin-left: 6.5rem; }

.cmp-requesteditemfieldset-name {
  margin-top: 1.25rem;
  margin-bottom: 0.5rem; }

.cmp-requesteditemfieldset-wrapper {
  margin-bottom: 1rem; }

.cmp-requesteditemcustomizeunitsactive-button {
  padding: 0;
  overflow: visible;
  width: 2.25rem;
  height: 2.25rem;
  color: #333; }

.cmp-requesteditemcustomizeunitsactive-iconwrapper {
  color: #333;
  height: 100%;
  width: 100%;
  border-radius: 50%;
  border: 1px solid #e3e3e3;
  -ms-flex-pack: center;
      justify-content: center;
  -ms-flex-align: center;
      align-items: center; }

.cmp-requesteditemcustomizeunitsactive-wrapper {
  -ms-flex-pack: center;
      justify-content: center;
  -ms-flex-align: center;
      align-items: center; }

.cmp-requesteditempill-wrapper {
  border: 1px solid #e3e3e3;
  border-radius: 1rem;
  display: inline-block;
  font-size: 0.875rem;
  padding: 0.2rem 0.5rem;
  text-decoration: none;
  margin-top: 0.5rem;
  margin-bottom: 0;
  display: -ms-inline-flexbox;
  display: inline-flex; }
  .cmp-requesteditempill-wrapper:hover {
    background-color: #e3e3e3; }
  .cmp-requesteditempill-wrapper.hollow {
    background-color: transparent;
    border: 1px solid #ddd; }
  .cmp-requesteditempill-wrapper.interactable {
    cursor: pointer; }

.cmp-requesteditempill-addicon {
  font-size: 1.2rem;
  margin: 0;
  margin-top: -0.15rem;
  color: #333; }

.cmp-reveal {
  padding: 1.5rem 2.25rem; }

.cmp-reveal-title {
  margin-bottom: 1.5rem; }

.cmp-reveal-hirechange {
  max-width: 35rem; }

.cmp-reveal-requesteditemdatapill {
  border: 1px solid #e3e3e3;
  border-radius: 1rem;
  display: inline-block;
  font-size: 0.875rem;
  padding: 0.2rem 0.5rem;
  text-decoration: none;
  cursor: auto; }
  .cmp-reveal-requesteditemdatapill:hover {
    background-color: #e3e3e3; }
  .cmp-reveal-requesteditemdatapill.hollow {
    background-color: transparent;
    border: 1px solid #ddd; }
  .cmp-reveal-requesteditemdatapill.interactable {
    cursor: pointer; }

.cmp-reveal-requesteditemdescedit {
  cursor: pointer;
  margin-left: 0.25rem; }

.cmp-reveal-requesteditemdescicon {
  margin-left: 0; }

.cmp-reveal-requesteditemexpandicon {
  display: none;
  cursor: pointer;
  margin-left: 0.5rem; }
  @media only screen and (min-width: 640px) {
    .cmp-reveal-requesteditemexpandicon {
      display: inline-block; } }

.cmp-reveal-requesteditempillscontainer {
  margin-top: 0.5rem; }

.cmp-reveal-requesteditemsecondarytext {
  font-size: 0.875rem;
  color: #757575; }

.cmp-reveal-requesteditemsection {
  margin-top: 2rem; }

@media only screen and (min-width: 640px) {
  .cmp-reveal-requesteditems {
    width: 40rem; } }

.cmp-reveal-reviewexternalbutton {
  margin: 0.5rem 0.5rem 0 0; }

.cmp-reveal-reviewexternalimage {
  margin: 2.5rem 0 0.5rem; }

.cmp-reveal-reviewexternaltext {
  margin: 0.5rem 0; }

.cmp-reveal-unperformingcolumn {
  margin: 0 auto;
  max-width: 20rem; }

.cmp-reveal-unperformingimage {
  margin-bottom: 0.5rem;
  margin-top: 1.5rem;
  max-width: 5rem; }

.cmp-reviewelement {
  position: relative; }
  .cmp-reviewelement + .cmp-reviewelement {
    margin-top: 1rem; }

.cmp-reviewelement-author {
  display: inline-block;
  margin-bottom: 0.1rem; }

.cmp-reviewelement-authorlabel {
  background-color: #757575;
  border-radius: 2px;
  color: #fefefe;
  display: inline-block;
  font-size: 0.875rem;
  font-weight: normal;
  margin-left: 0 0.25rem;
  padding: 0.15rem 0.5rem;
  position: relative;
  top: -0.1rem; }

.cmp-reviewelement-body {
  margin: 0.2rem 0; }

.cmp-reviewelement-date {
  display: inline-block;
  margin-left: 0.25rem; }

.cmp-reviewelement-ratingagain {
  color: #757575;
  font-size: 0.875rem; }

.cmp-reviewelement-ratingcheck {
  font-size: 0.875rem;
  margin: 0 0.25rem 0 0; }

.cmp-reviewelement-ratingstar {
  margin: 0; }

.cmp-reviewelement-ratingwrapper {
  font-size: 0.875rem;
  margin-right: 1.5rem; }

.cmp-reviewelement-texts {
  margin-left: 2.5rem; }

.cmp-reviewelement-usericon, .cmp-reviewelement-userpicture {
  display: inline-block;
  height: 2rem;
  padding: 0.25rem 0;
  position: absolute;
  width: 2rem; }

.cmp-reviewelement-usericon {
  border-radius: 50%;
  color: #fefefe;
  margin: 0 auto;
  text-align: center; }
  .cmp-reviewelement-usericon:empty:after {
    content: "\f007";
    font-family: "FontAwesome"; }

.cmp-reviewelement-userpicture {
  background-color: #fefefe;
  background-position: center;
  background-repeat: no-repeat;
  background-size: cover;
  border-radius: 50%; }

.cmp-reviewfields-again input[type=radio] + label {
  padding: 0 0.5rem; }
  .cmp-reviewfields-again input[type=radio] + label:after, .cmp-reviewfields-again input[type=radio] + label:before {
    display: none; }
  .cmp-reviewfields-again input[type=radio] + label i:hover {
    color: #e75635; }

.cmp-reviewfields-again input[type=radio]:checked + label i {
  color: #e75635; }

.cmp-reviewfields-again i, .cmp-reviewfields-rating i {
  color: #e3e3e3;
  cursor: pointer;
  font-size: 2.5rem; }

.cmp-reviewfields-again .fa-asterisk, .cmp-reviewfields-rating .fa-asterisk {
  font-size: 0.7rem;
  position: relative;
  top: -0.2rem; }

.cmp-reviewfields-comment textarea {
  height: 5rem;
  min-height: 5rem; }

.cmp-reviewfields-grid.row {
  margin-bottom: 0.75rem;
  margin-top: 0.75rem; }

.cmp-reviewfields-grid .column, .cmp-reviewfields-grid .columns {
  padding-bottom: 0.375rem;
  padding-top: 0.375rem; }

.cmp-reviewfields-rating {
  position: relative; }
  .cmp-reviewfields-rating span > i {
    opacity: 0.2; }

@keyframes bounce {
  0% {
    transform: scale(1);
    opacity: 1; }
  40% {
    transform: scale(0.2);
    opacity: .7; }
  60% {
    transform: scale(0.9);
    opacity: 1; }
  80% {
    transform: scale(1.05); }
  100% {
    transform: scale(1); } }
    .cmp-reviewfields-rating span > i:nth-child(1), .cmp-reviewfields-rating span > i:nth-child(2), .cmp-reviewfields-rating span > i:nth-child(3) {
      color: #cc4b37; }
    .cmp-reviewfields-rating span > i:nth-child(4) {
      color: #ffae00; }
    .cmp-reviewfields-rating span > i:nth-child(5) {
      color: #66c17b; }
    .cmp-reviewfields-rating span > i.full {
      animation-name: bounce;
      animation-duration: 1s;
      opacity: 1; }
      .cmp-reviewfields-rating span > i.full:nth-child(1) {
        animation-delay: .05s; }
      .cmp-reviewfields-rating span > i.full:nth-child(2) {
        animation-delay: .1s; }
      .cmp-reviewfields-rating span > i.full:nth-child(3) {
        animation-delay: .15s; }
      .cmp-reviewfields-rating span > i.full:nth-child(4) {
        animation-delay: .2s; }
      .cmp-reviewfields-rating span > i.full:nth-child(5) {
        animation-delay: .25s; }
    .cmp-reviewfields-rating span > i.hovered {
      opacity: 1; }
  .cmp-reviewfields-rating select {
    height: 1px;
    opacity: 0;
    padding: 10px;
    position: absolute;
    top: 0;
    width: 1px; }

.cmp-rfpupsellingbanner {
  background-color: #f7f7f7;
  padding: 1rem 1.5rem; }
  @media only screen and (min-width: 640px) {
    .cmp-rfpupsellingbanner {
      padding: 1.75rem 2.625rem; } }

.cmp-rfpupsellingbanner-content {
  padding-right: 1rem; }
  @media only screen and (min-width: 640px) {
    .cmp-rfpupsellingbanner-content {
      -ms-flex-order: 1;
          order: 1; } }

@media only screen and (min-width: 640px) {
  .cmp-rfpupsellingbanner-image {
    -ms-flex-order: 2;
        order: 2; } }

.cmp-rrule-byweekdayelement {
  margin-right: 0.9rem; }

input[type=checkbox] + label.cmp-rrule-checkboxlabel {
  margin-top: 0.25rem; }

.cmp-rrule-countinput {
  display: inline;
  height: 2.5rem;
  padding: 0.5rem 1rem;
  width: 5rem; }

.cmp-rrule-custombutton {
  margin-top: 0.5rem;
  position: relative;
  top: -0.1rem; }
  @media only screen and (min-width: 640px) {
    .cmp-rrule-custombutton {
      margin-top: 0; } }

.cmp-rrule-datetoggle {
  gap: 1rem; }

.cmp-rrule-datetimeinput {
  height: 2.5rem;
  padding: 0.5rem 1rem;
  width: auto; }
  @media only screen and (min-width: 640px) {
    .cmp-rrule-datetimeinput {
      display: inline; } }

.cmp-rrule-endelement {
  margin-bottom: 0.5rem; }
  @media only screen and (min-width: 640px) {
    .cmp-rrule-endelement {
      margin-bottom: 0; } }
  .cmp-rrule-endelement input[type=radio] + label:after, .cmp-rrule-endelement input[type=radio] + label:before {
    top: 14px; }

.cmp-rrule-frequencyelement {
  margin: 0.15rem 0; }

.cmp-rrule-login {
  font-size: 0.875rem; }

.cmp-rrule-monthrepeatelement {
  margin-right: 0.9rem; }

.cmp-rrule-rulestext {
  margin-top: 0.25rem; }
  .cmp-rrule-rulestext::first-letter {
    text-transform: uppercase; }

.cmp-rrule-summarybutton {
  margin-top: 0.25rem; }

.cmp-rrule-summaryelement {
  margin-top: 0.25rem; }
  .cmp-rrule-summaryelement .fa.circular {
    min-height: 1.3em;
    min-width: 1.3em;
    padding: 0.15em; }

.cmp-selectcustom {
  padding: 0.75rem 1.5rem;
  position: absolute;
  top: 3.4rem; }

.cmp-selectcustom-grid.row {
  margin-left: -0.375rem;
  margin-right: -0.375rem; }

.cmp-selectcustom-group {
  color: #757575;
  font-size: 0.875rem;
  padding: 0.5rem 0.375rem 0; }

.cmp-selectcustom-location {
  cursor: pointer;
  padding: 0.375rem 0.375rem 0.375rem 0.75rem; }
  .cmp-selectcustom-location:hover {
    background-color: #eee; }

.cmp-seodescription h2 {
  margin-top: 1rem;
  margin-bottom: 0.5rem; }

.cmp-seodescription h3 {
  margin-bottom: 0.3rem; }

.cmp-seodescription p {
  margin-bottom: 0.3rem; }

.cmp-seofaq-accordioncontent {
  padding-left: 2.25rem;
  padding-top: 0.75rem; }

.cmp-seofaq-accordionitem {
  margin-bottom: 0; }

.cmp-seofaq-accordiontitle {
  line-height: 1.5;
  padding-bottom: 0.375rem;
  padding-left: 0;
  padding-top: 0.375rem; }

.cmp-seofaq-accordiontitleicon {
  position: relative;
  top: 0.325rem; }
  .cmp-seofaq-accordiontitleicon.material-icons {
    font-size: 1.25rem; }

.cmp-seohelp {
  padding: 0.5rem 0.875rem;
  position: relative; }
  @media only screen and (min-width: 960px) {
    .cmp-seohelp {
      padding: 1rem 1.5rem; } }

.cmp-seohelp-button {
  margin-top: 0.25rem; }

.cmp-seohelp-image {
  height: 3.5rem;
  width: 3.5rem; }
  @media only screen and (min-width: 640px) {
    .cmp-seohelp-image {
      position: absolute; } }

.cmp-seohelp-icon {
  font-size: 3.5rem; }
  @media only screen and (min-width: 640px) {
    .cmp-seohelp-icon {
      position: absolute; } }
  @media only screen and (min-width: 640px) {
    .cmp-seohelp-icon {
      top: 50%; } }
  @media only screen and (min-width: 640px) {
    .cmp-seohelp-icon {
      -ms-transform: translateY(-50%);
          transform: translateY(-50%); } }

.cmp-seohelp-texts {
  margin: 0.25rem 0; }
  @media only screen and (min-width: 640px) {
    .cmp-seohelp-texts {
      margin: 0.25rem 0 0.25rem 4.5rem; } }

.cmp-seohelp-title {
  margin-bottom: 0.25rem; }

.cmp-seohelp {
  text-align: left; }

.cmp-seohelp-action {
  margin-top: 1rem; }

.cmp-seolinks {
  padding-bottom: 2rem;
  padding-top: 2rem;
  text-align: center; }

.cmp-seolinks-row {
  margin-bottom: 0.25rem;
  margin-top: 0.5rem;
  display: -ms-flexbox;
  display: flex;
  -ms-flex-wrap: wrap;
      flex-wrap: wrap;
  row-gap: 0.5rem;
  column-gap: 0.2rem; }

.cmp-serviceform-additional {
  margin-top: 1rem; }

.cmp-serviceform-current {
  margin-top: 0.2rem; }

.cmp-serviceform-description {
  border-top: 1px solid #ccc;
  margin-top: 1.5rem;
  padding-top: 2rem; }
  .cmp-serviceform-description .row .column, .cmp-serviceform-description .row .columns {
    padding-bottom: 0.25rem;
    padding-top: 0.25rem; }

.cmp-serviceform-grid.row {
  margin-left: -0.5rem;
  margin-right: -0.5rem; }

.cmp-serviceform-grid .column, .cmp-serviceform-grid .columns {
  padding: 0.5rem; }

.cmp-serviceform-input {
  border-bottom: 1px solid transparent;
  height: 3rem;
  padding: 1rem 0.6rem; }

.cmp-serviceform-label {
  color: #757575;
  font-size: 0.875rem; }

.cmp-serviceform-link {
  display: block;
  margin-bottom: 0.5rem;
  margin-top: 1rem; }

.cmp-serviceform-modes .row {
  margin-left: -0.5rem;
  margin-right: -0.5rem; }
  .cmp-serviceform-modes .row .column, .cmp-serviceform-modes .row .columns {
    padding: 0.5rem; }

.cmp-serviceform-options {
  margin-top: 0.5rem; }

.cmp-serviceform-radio {
  background-color: #ddd;
  border-radius: 2px;
  padding: 0.75rem 0 0.75rem 0.875rem; }
  .cmp-serviceform-radio label::first-letter {
    text-transform: uppercase; }

.cmp-serviceform-text {
  font-size: 0.875rem; }

.cmp-servicepicker {
  padding: 0.4rem 0;
  position: relative; }
  .cmp-servicepicker input:checked + label .cmp-servicepicker-icon {
    background-position-y: 0%; }

.cmp-servicepicker-icon {
  background-size: 100%;
  height: 1.25rem;
  position: absolute;
  top: 0;
  width: 1.25rem; }

.cmp-servicepicker-text {
  margin-left: 1.5rem; }

.cmp-servicesreflectguestnum-text {
  margin-top: 0.5rem; }
  .cmp-servicesreflectguestnum-text a {
    margin-left: 0.25rem; }

.cmp-sortablechoices {
  display: -ms-flexbox;
  display: flex;
  -ms-flex-wrap: wrap;
      flex-wrap: wrap;
  row-gap: 0.5rem;
  column-gap: 0.2rem; }
  .cmp-sortablechoices label[for$=-DELETE] {
    display: none; }
  .cmp-sortablechoices .cmp-chip {
    cursor: move; }

.cmp-spacecapacity-label {
  margin-left: 2.75rem; }

.cmp-spacecapacity-stack {
  position: relative; }
  .cmp-spacecapacity-stack.unavailable {
    opacity: 0.35; }
  .cmp-spacecapacity-stack img {
    height: 2.1rem;
    left: 0;
    position: absolute;
    top: 0.2rem;
    width: 2.1rem; }

.cmp-spacecapacity-value {
  margin-left: 2.75rem; }

.cmp-spaceguarantee-divider {
  height: 1px;
  width: 100%;
  background-color: rgba(117, 117, 117, 0.75); }

.cmp-spaceguarantee-herotext {
  color: #333; }
  .cmp-spaceguarantee-herotext.medium {
    font-size: 1.2rem; }
  .cmp-spaceguarantee-herotext.large {
    font-size: 1.75rem; }
  .cmp-spaceguarantee-herotext.gray {
    font-weight: bold;
    color: #aaa; }

.cmp-spaceguarantee-link {
  margin-bottom: 0.25rem; }

.cmp-spaceguarantee-wrapper {
  margin-top: 1rem;
  margin-bottom: 1rem;
  row-gap: 0.5rem; }

.cmp-structuredquoteable tbody {
  border: 2px solid #555;
  border-collapse: collapse; }

.cmp-structuredquoteable td {
  border: 1px solid #ccc; }

.cmp-hiretable-highlight {
  text-transform: uppercase; }

.cmp-hiretable-total {
  background-color: #f7f7f7; }

input[type=checkbox].cmp-cardcheckbox-input + label {
  display: block;
  padding-left: 0; }

input[type=checkbox].cmp-cardcheckbox-input + label:before {
  border-radius: 50%;
  height: 24px;
  left: 1rem;
  position: absolute;
  top: 1rem;
  width: 24px;
  z-index: 100; }

input[type=checkbox].cmp-cardcheckbox-input:checked + label:after {
  left: 1.375rem;
  position: absolute;
  top: 1.375rem;
  z-index: 100; }

.cmp-cardcheckbox-wrapper {
  position: relative; }
  .cmp-cardcheckbox-wrapper.disabled {
    pointer-events: none;
    opacity: 0.25; }

.cmp-spacetypelist-anchor:hover {
  opacity: 0.75; }

.cmp-spacetypelist-icon {
  height: 1.75rem;
  object-fit: cover; }

.cmp-spacetypelist-text {
  font-size: 0.875rem;
  padding-bottom: 0.5rem;
  padding-top: 0.25rem;
  white-space: nowrap; }

.cmp-spacetypelist-wrapper {
  display: -ms-flexbox;
  display: flex;
  scrollbar-width: thin;
  scrollbar-color: #e3e3e3 transparent;
  gap: 2rem;
  margin-top: 1rem;
  overflow-x: auto; }
  .cmp-spacetypelist-wrapper::-webkit-scrollbar {
    height: 6px; }
  .cmp-spacetypelist-wrapper::-webkit-scrollbar-thumb {
    background-color: #e3e3e3;
    border-radius: 2px; }
  @media only screen and (min-width: 640px) {
    .cmp-spacetypelist-wrapper {
      margin-top: 2rem; } }

.cmp-spinningcircle {
  border-radius: 50%;
  color: #757575;
  display: none;
  font-size: 1rem;
  text-indent: -99999em;
  margin-left: 0.1em;
  position: relative;
  width: 1em;
  height: 1em;
  box-shadow: inset 0 0 0 0.2em;
  -ms-transform: translateZ(0);
  transform: translateZ(0); }

@keyframes spinning {
  0% {
    transform: rotate(0deg); }
  100% {
    transform: rotate(360deg); } }
  .cmp-spinningcircle:before, .cmp-spinningcircle:after {
    border-radius: 50%;
    content: '';
    position: absolute; }
  .cmp-spinningcircle:before {
    width: 0.54em;
    height: 1.04em;
    background: #fefefe;
    border-radius: 1.04em 0 0 1.04em;
    top: -0.02em;
    left: -0.02em;
    -ms-transform-origin: 0.54em 0.52em;
        transform-origin: 0.54em 0.52em;
    animation: spinning 2s infinite ease 1.5s; }
  .cmp-spinningcircle:after {
    width: 0.54em;
    height: 1.04em;
    background: #fefefe;
    border-radius: 0 1.04em 1.04em 0;
    top: -0.02em;
    left: 0.52em;
    -ms-transform-origin: 0px 0.52em;
        transform-origin: 0px 0.52em;
    animation: spinning 2s infinite ease; }

.cmp-stripepayment {
  position: relative;
  margin-top: 0.5rem; }

.cmp-stripepayment-badge {
  height: 1.5rem; }

.cmp-stripepayment-existingcard {
  display: inline-block;
  margin: 0 0.5rem 0.5rem 0;
  padding: 0.5rem 0.75rem 0.5rem 0.5rem;
  position: relative;
  text-decoration: none; }

.cmp-stripepayment-existingcards {
  padding-bottom: 0.5rem; }

.cmp-stripepayment-existingicon {
  position: absolute; }

.cmp-stripepayment-existinglabel {
  color: #aaa;
  font-size: 0.875rem;
  margin-bottom: 0.25rem; }

.cmp-stripepayment-existingtext {
  display: block;
  margin-left: 1.75rem; }
  .cmp-stripepayment-existingtext.small {
    color: #aaa;
    font-size: 0.875rem; }

.cmp-stripepayment-errors {
  color: #cc4b37;
  font-size: 0.875rem;
  margin: 0.5rem 0; }

.cmp-stripepayment-input {
  border-bottom: 1px solid transparent;
  box-shadow: 0 1px 3px 0 #eff2f5;
  font-family: Arial;
  height: 40px;
  padding: 10px 12px;
  margin-bottom: 0.5rem; }
  .cmp-stripepayment-input:focus {
    border-bottom: 1px solid transparent;
    box-shadow: 0 1px 3px 0 #cfd7df; }

.cmp-survey-buttons {
  text-align: center; }
  .cmp-survey-buttons .button {
    margin: 0 auto 0.25rem; }

.cmp-survey-columnarcheckboxes .row {
  margin-right: 0;
  margin-left: 0; }

.cmp-survey-columnarcheckboxes .column, .cmp-survey-columnarcheckboxes .columns {
  padding: 0.5rem 0 0; }

.cmp-survey-comment {
  color: #757575;
  font-size: 0.875rem; }

.cmp-survey-criteria {
  margin-bottom: 1rem; }

.cmp-survey-divider {
  margin: 0.75rem 0; }

.cmp-survey-explanationlist li p {
  margin-bottom: 0.5rem; }

.cmp-survey-fields {
  margin: 2.5rem auto;
  max-width: 30rem; }
  .cmp-survey-fields.large {
    max-width: 45rem; }
  .cmp-survey-fields select {
    margin-bottom: 0.5rem; }
    .cmp-survey-fields select option:first-child {
      color: #ccc; }
  .cmp-survey-fields textarea {
    height: 6rem;
    min-height: 6rem; }

.cmp-survey-success {
  margin: 2.5rem 0;
  text-align: center; }

.cmp-survey-successicon {
  font-size: 5rem;
  margin-bottom: 1.5rem; }

.cmp-survey-successtitle {
  margin-bottom: 1rem;
  text-transform: uppercase; }

.cmp-survey-text {
  margin-bottom: 0.5rem; }

.cmp-survey-textsecondary {
  font-size: 0.85rem; }

.cmp-survey-title {
  margin-bottom: 1rem;
  text-align: center;
  text-transform: uppercase; }

.cmp-filtertags-container:not(:empty) {
  margin-bottom: 0.5rem; }

.cmp-filtertags-element {
  background-color: #fbe4df;
  border-radius: 2px;
  color: #e75635;
  display: inline-block;
  font-size: 0.875rem;
  padding: 0.15rem 0.5rem;
  margin: 0.1rem; }

.cmp-filtertags-elementcloseicon {
  font-size: 1rem;
  margin-left: 0.25rem;
  margin-right: 0; }

.cmp-testimonials {
  padding: 0 1rem; }

.cmp-testimonials-comment {
  margin: 0 0 0.5rem 0; }

.cmp-testimonials-element {
  margin: 1rem; }

.cmp-testimonials-image {
  border-radius: 50%;
  background-position: center center;
  background-size: cover;
  height: 3rem;
  width: 3rem; }
  @media only screen and (min-width: 960px) {
    .cmp-testimonials-image {
      height: 7rem; } }
  @media only screen and (min-width: 960px) {
    .cmp-testimonials-image {
      margin: 0 auto; } }
  @media only screen and (min-width: 960px) {
    .cmp-testimonials-image {
      position: absolute; } }
  @media only screen and (min-width: 960px) {
    .cmp-testimonials-image {
      width: 7rem; } }

.cmp-testimonials-logo {
  height: 2.5rem;
  position: relative;
  top: -0.15rem; }
  .cmp-testimonials-logo.large {
    height: 5rem;
    margin: 0 auto; }

.cmp-testimonials-name {
  display: inline-block;
  margin-right: 0.5rem;
  margin-top: 1rem; }

.cmp-testimonials-position {
  color: #aaa;
  display: inline-block;
  margin-left: 0.5rem;
  margin-top: 0.75rem; }

.cmp-testimonials-statement {
  font-style: italic;
  margin: 0; }

.cmp-testimonials-texts {
  margin-top: 0.75rem; }
  @media only screen and (min-width: 960px) {
    .cmp-testimonials-texts {
      margin-left: 9.5rem; } }
  @media only screen and (min-width: 960px) {
    .cmp-testimonials-texts {
      margin-top: 0; } }

.cmp-timerange-field[readonly] {
  cursor: pointer; }

.cmp-tile-actionsexpandercard {
  z-index: 105;
  gap: 0.5rem;
  padding: 1rem; }
  .cmp-tile-actionsexpandercard.dropdown-pane {
    width: 10rem;
    font-size: 1rem; }
    .cmp-tile-actionsexpandercard.dropdown-pane.large {
      width: 15rem; }

.cmp-tile-actionsexpandercontents {
  -ms-flex-align: start;
      align-items: flex-start;
  gap: 1rem; }

.cmp-tile-actionsexpandericon {
  margin-left: 0.75rem; }
  .cmp-tile-actionsexpandericon:hover {
    color: #757575; }

.cmp-tilebasicinfoitem-wrapper i {
  color: #757575;
  margin: 0;
  margin-right: 0.1rem;
  font-size: 1rem; }

.card {
  overflow: visible; }

.cmp-tilebooking-actions {
  margin-top: auto; }
  .cmp-tilebooking-actions .button {
    margin: 0.125rem;
    padding: 0.55rem 0.7rem 0.5rem !important; }

.cmp-tilebooking-avatar {
  aspect-ratio: 1/1;
  height: 3rem;
  border-radius: 50%; }

.cmp-tilebooking-arrow {
  color: transparent;
  cursor: pointer;
  outline-color: transparent;
  position: absolute;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%); }
  .cmp-tilebooking-arrow:before {
    color: #fefefe;
    font-family: FontAwesome;
    font-size: 3.5rem;
    font-weight: normal;
    opacity: 0.75;
    padding: 0 1.15rem; }
  .cmp-tilebooking-arrow.left {
    left: 0; }
    .cmp-tilebooking-arrow.left:before {
      content: "\f104"; }
  .cmp-tilebooking-arrow.right {
    right: 0; }
    .cmp-tilebooking-arrow.right:before {
      content: "\f105"; }

.cmp-tilebooking-carousel {
  height: 100%;
  position: absolute;
  top: 0;
  bottom: 0;
  left: 0;
  right: 0;
  width: auto; }
  .cmp-tilebooking-carousel .cmp-tilebooking-carouselfirst {
    background-color: #333;
    height: 100%;
    overflow: hidden;
    text-align: center; }
  .cmp-tilebooking-carousel img {
    height: 100%;
    margin: 0 auto;
    max-width: none; }
    .cmp-tilebooking-carousel img:not([src]) {
      display: none; }

.cmp-tilebooking-basicinfowrapper {
  column-gap: 0.75rem;
  row-gap: 0.25rem; }
  .cmp-tilebooking-basicinfowrapper:not(:empty) {
    margin-top: 0.75rem;
    margin-bottom: 0.5rem; }

.cmp-tilebooking-contentcontainer {
  row-gap: 0.75rem; }
  .cmp-tilebooking-contentcontainer i {
    font-size: 0.875rem; }

.cmp-tilebooking-divider {
  border-bottom: 1px solid #ccc;
  display: block;
  margin: 0.5rem auto; }

.cmp-tilebooking-id {
  color: #757575;
  font-size: 0.875rem;
  padding: 0 0.05rem 0.15rem; }

.cmp-tilebooking-info {
  padding: 0.5rem 1rem; }

.cmp-tilebooking-inlineform {
  display: inline-block; }

.cmp-tilebooking-pricesub {
  color: #757575;
  font-size: 0.875rem; }

.cmp-tilebooking-pricetext {
  display: inline-block; }

.cmp-tilebooking-linkwrapper {
  text-decoration: none; }

.cmp-tilebooking-rating {
  color: #555;
  margin: 0; }

.cmp-tilebooking-value {
  padding: 0.25rem 0; }
  .cmp-tilebooking-value:not(.untrimmed) {
    overflow: hidden;
    text-overflow: ellipsis;
    white-space: nowrap; }

.cmp-tilebooking-valueicon {
  color: #757575;
  display: inline-block;
  font-size: 1.5rem;
  text-align: center;
  vertical-align: middle;
  width: 1.5rem; }

.cmp-tilebooking-valuelabel {
  color: #757575;
  font-size: 0.875rem; }

.cmp-tilebooking-wrapper {
  position: relative;
  width: 100%;
  overflow: hidden; }
  .cmp-tilebooking-wrapper.image {
    background-clip: content-box;
    background-position: center center;
    background-repeat: no-repeat;
    background-size: cover;
    height: 7.5rem; }

.cmp-tilebooking {
  clear: none !important;
  position: relative; }

.cmp-tilebooking-datevalue {
  display: inline-block; }
  @media only screen and (min-width: 640px) {
    .cmp-tilebooking-datevalue {
      display: block; } }

.cmp-tilebooking-id {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap; }

.cmp-tilebooking-wrapper.carousel {
  padding-top: 75%; }

.cmp-tilebooking-wrapper.content {
  position: relative; }
  .cmp-tilebooking-wrapper.content::after {
    background-color: rgba(51, 51, 51, 0.5);
    bottom: 0;
    content: " ";
    height: 100%;
    left: 0;
    position: absolute;
    width: 100%; }

.cmp-tileeventmodel:not(.simplified):hover .cmp-tileeventmodel-content {
  height: 5.7rem;
  white-space: normal; }

.cmp-tileeventmodel:not(.simplified):hover .cmp-tileeventmodel-wrapper {
  height: 5rem; }
  @media only screen and (min-width: 1280px) {
    .cmp-tileeventmodel:not(.simplified):hover .cmp-tileeventmodel-wrapper {
      height: 7rem; } }

.cmp-tileeventmodel-actions {
  padding: 0 1rem 0.75rem; }

.cmp-tileeventmodel-content {
  height: 0;
  overflow: hidden;
  transition: height 0.5s cubic-bezier(0.37, 0.75, 0.61, 1.05) 0s; }

.cmp-tileeventmodel-image {
  background-repeat: no-repeat;
  background-position: center;
  background-size: cover;
  width: 100%;
  height: 100%; }

.cmp-tileeventmodel-info {
  padding: 0.5rem 1rem; }

.cmp-tileeventmodel-name {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap;
  padding-bottom: 0.25rem; }

.cmp-tileeventmodel-tag {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap; }

.cmp-tileeventmodel-wrapper {
  height: 10.7rem;
  position: relative;
  transition: height 0.5s cubic-bezier(0.37, 0.75, 0.61, 1.05) 0s; }
  @media only screen and (min-width: 1280px) {
    .cmp-tileeventmodel-wrapper {
      height: 12.7rem; } }

.cmp-tilefull .row.collapse {
  margin-bottom: 0.5rem; }
  .cmp-tilefull .row.collapse .column, .cmp-tilefull .row.collapse .columns {
    padding-bottom: 0;
    padding-top: 0; }

.cmp-tilefull-actions .button {
  margin: 0.125rem; }

.cmp-tilefull-actionsbooking {
  text-align: left; }

.cmp-tilefull-actionwrapper {
  margin-top: 1.5rem; }

.cmp-tilefull-arrow-arrow {
  color: transparent;
  cursor: pointer;
  outline-color: transparent;
  position: absolute;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%); }
  .cmp-tilefull-arrow-arrow:before {
    color: #fefefe;
    font-family: FontAwesome;
    font-size: 3.5rem;
    font-weight: normal;
    opacity: 0.75;
    padding: 0 1.15rem; }
  .cmp-tilefull-arrow-arrow.left {
    left: 0; }
    .cmp-tilefull-arrow-arrow.left:before {
      content: "\f104"; }
  .cmp-tilefull-arrow-arrow.right {
    right: 0; }
    .cmp-tilefull-arrow-arrow.right:before {
      content: "\f105"; }

.cmp-tilefull-capacity {
  margin: 1rem auto; }

.cmp-tilefull-badge {
  width: 8rem; }

.cmp-tilefull-capacityelement {
  display: inline-block;
  margin-left: 1.5rem; }
  .cmp-tilefull-capacityelement.unavailable {
    opacity: 0.5; }

.cmp-tilefull-capacityimage {
  height: 1.2rem;
  position: relative;
  top: -0.05rem;
  width: 1.2rem; }

.cmp-tilefull-capacitylabel {
  color: #757575;
  font-size: 0.875rem; }

.cmp-tilefull-capacityvalue {
  margin-left: 0.5rem; }

.cmp-tilefull-carousel {
  height: 100%;
  position: absolute;
  top: 0;
  bottom: 0;
  left: 0;
  right: 0;
  width: auto; }
  .cmp-tilefull-carousel .cmp-tilefull-carouselfirst {
    background-color: #333;
    height: 100%;
    overflow: hidden;
    text-align: center; }
  .cmp-tilefull-carousel img {
    height: 100%;
    margin: 0 auto;
    max-width: none; }
    .cmp-tilefull-carousel img:not([src]) {
      display: none; }

.cmp-tilefull-clickablearea {
  bottom: 0;
  cursor: pointer;
  left: 12.5%;
  position: absolute;
  right: 12.5%;
  top: 0;
  z-index: 102; }

.cmp-tilefull-divider {
  border-bottom: 1px solid #ccc;
  display: block;
  margin: 0.5rem auto; }

.cmp-tilefull-info {
  padding: 0.75rem 1.5rem; }

.cmp-tilefull-introtext {
  margin-top: 0.5rem; }

.cmp-tilefull-overlay {
  color: #fefefe;
  height: 100%;
  padding-top: 37.5%;
  position: absolute;
  text-align: center;
  top: 0;
  bottom: 0;
  left: 0;
  right: 0;
  width: 100%;
  z-index: 105; }
  .cmp-tilefull-overlay.dark {
    background-color: rgba(0, 0, 0, 0.8); }
  .cmp-tilefull-overlay.light {
    background-color: rgba(0, 0, 0, 0.35);
    height: calc(100% - 2.4rem);
    padding-top: calc(37.5% - 1.2rem); }
  .cmp-tilefull-overlay .button {
    margin-bottom: 0.25rem;
    margin-top: 0.25rem; }
  .cmp-tilefull-overlay .cmp-tilefull-overlay-content {
    padding: 0 1rem;
    -ms-transform: translateY(-50%);
        transform: translateY(-50%); }

.cmp-tilefull-pricing {
  margin: 1rem auto; }

.cmp-tilefull-pricingelement {
  display: inline-block;
  margin-right: 1.5rem;
  position: relative; }

.cmp-tilefull-pricingimage {
  height: 1.5rem;
  opacity: 0.5;
  position: absolute;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%);
  width: 1.5rem; }

.cmp-tilefull-pricinglabel {
  color: #757575;
  font-size: 0.875rem; }

.cmp-tilefull-pricingtext {
  display: inline-block;
  margin-left: 2rem; }

.cmp-tilefull-rating {
  margin: 0; }

.cmp-tilefull-subtitle {
  color: #757575; }

.cmp-tilefull-tag {
  background-color: #e7e7e7;
  border-radius: 1rem;
  color: #fefefe;
  display: inline-block;
  font-size: 0.875rem;
  padding: 0.15rem 0.5rem;
  margin: 0.1rem; }

.cmp-tilefull-tag.alert {
  background-color: #cc4b37; }

.cmp-tilefull-tag.primary {
  background-color: #e75635; }

.cmp-tilefull-tag.success {
  background-color: #66c17b; }

.cmp-tilefull-tags {
  margin: 0.5rem 0 1.5rem; }

.cmp-tilefull-title {
  max-height: 5.1rem;
  overflow: hidden; }

.cmp-tilefull-value {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap;
  margin-bottom: 0.5rem; }
  @media only screen and (min-width: 960px) {
    .cmp-tilefull-value {
      margin-bottom: 0; } }

@media only screen and (min-width: 960px) {
  .cmp-tilefull-valuelabel {
    display: block; } }

.cmp-tilefull-wishlist {
  display: inline-block;
  margin-left: 0.5rem;
  z-index: 103; }
  .cmp-tilefull-wishlist i {
    font-size: 1.35rem;
    margin: 0; }
  .cmp-tilefull-wishlist .dropdown-pane {
    left: -3rem !important; }

.cmp-tilefull-wrapper {
  position: relative;
  padding-top: 75%;
  width: 100%; }

.cmp-tilehireset-actions {
  margin-top: 0.5rem; }
  .cmp-tilehireset-actions .button {
    font-size: 0.875rem;
    padding: 0.55rem 0.7rem 0.5rem !important; }

.cmp-tilehireset-detail {
  position: relative; }

.cmp-tilehireset-detailicon {
  font-size: 1.25rem;
  margin: 0;
  position: absolute;
  text-align: center;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%);
  width: 2rem; }

.cmp-tilehireset-detailtext {
  padding: 0.25rem 0;
  margin-left: 2.25rem; }

.cmp-tilehireset-detail {
  margin-bottom: 0.25rem; }

.cmp-tilehireset-detail-label {
  color: #757575;
  font-size: 0.875rem; }

.cmp-tilehireset-info {
  padding: 0.75rem; }

.cmp-tilehireset-inlineform {
  display: inline-block; }

.cmp-tilehireset-intro {
  margin-bottom: 0.5rem; }

.cmp-tilehireset-introlink {
  padding-left: 0.2rem; }

.cmp-tilehireset-introtag {
  background-color: #e7e7e7;
  border-radius: 2px;
  color: #aaa;
  display: inline-block;
  font-size: 0.875rem;
  padding: 0.15rem 0.5rem;
  margin: 0.1rem; }

.cmp-tilehireset-new {
  border: 3px dashed #e7e7e7;
  border-radius: 2px;
  height: calc(100% - 1.75rem);
  margin-top: 0.75rem;
  min-height: 10rem;
  position: relative;
  text-align: center; }

.cmp-tilehireset-newcontent {
  left: 0;
  position: absolute;
  right: 0;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%); }

.cmp-tilehireset-space {
  overflow: hidden;
  position: relative; }

.cmp-tilehireset-spacetitle {
  color: #757575;
  font-size: 0.875rem;
  left: 5.5rem;
  position: absolute;
  right: 0.5rem;
  top: 0.7rem; }

.cmp-tilehireset-spaceimage {
  background-repeat: no-repeat;
  background-position: center;
  background-size: cover;
  width: 100%;
  height: 3.2rem;
  width: 4.8rem; }

.cmp-tilehome {
  display: inline-block;
  margin: 0 0.625rem 1rem;
  vertical-align: top;
  width: 18rem; }

.cmp-tilehome-content {
  padding: 0.75rem 1.25rem;
  white-space: normal; }

.cmp-tilehome-image {
  background-repeat: no-repeat;
  background-position: center;
  background-size: cover;
  width: 100%;
  padding-bottom: 66%; }

.cmp-tilehome-svg {
  height: 1.5rem;
  margin-bottom: 0.5rem;
  width: 1.5rem; }
  @media only screen and (min-width: 960px) {
    .cmp-tilehome-svg {
      height: 2.5rem; } }
  @media only screen and (min-width: 960px) {
    .cmp-tilehome-svg {
      width: 2.5rem; } }

.cmp-tilehome-title {
  margin-bottom: 0.25rem; }

.card {
  overflow: visible; }

.cmp-tilelist-actions {
  margin-top: auto; }
  .cmp-tilelist-actions .button {
    margin: 0.125rem;
    padding: 0.55rem 0.7rem 0.5rem !important; }

.cmp-tilelist-avatar {
  aspect-ratio: 1/1;
  height: 3rem;
  border-radius: 50%; }

.cmp-tilelist-arrow {
  color: transparent;
  cursor: pointer;
  outline-color: transparent;
  position: absolute;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%); }
  .cmp-tilelist-arrow:before {
    color: #fefefe;
    font-family: FontAwesome;
    font-size: 3.5rem;
    font-weight: normal;
    opacity: 0.75;
    padding: 0 1.15rem; }
  .cmp-tilelist-arrow.left {
    left: 0; }
    .cmp-tilelist-arrow.left:before {
      content: "\f104"; }
  .cmp-tilelist-arrow.right {
    right: 0; }
    .cmp-tilelist-arrow.right:before {
      content: "\f105"; }

.cmp-tilelist-carousel {
  height: 100%;
  position: absolute;
  top: 0;
  bottom: 0;
  left: 0;
  right: 0;
  width: auto; }
  .cmp-tilelist-carousel .cmp-tilelist-carouselfirst {
    background-color: #333;
    height: 100%;
    overflow: hidden;
    text-align: center; }
  .cmp-tilelist-carousel img {
    height: 100%;
    margin: 0 auto;
    max-width: none; }
    .cmp-tilelist-carousel img:not([src]) {
      display: none; }

.cmp-tilelist-basicinfowrapper {
  column-gap: 0.75rem;
  row-gap: 0.25rem; }
  .cmp-tilelist-basicinfowrapper:not(:empty) {
    margin-top: 0.75rem;
    margin-bottom: 0.5rem; }

.cmp-tilelist-contentcontainer {
  row-gap: 0.75rem; }
  .cmp-tilelist-contentcontainer i {
    font-size: 0.875rem; }

.cmp-tilelist-divider {
  border-bottom: 1px solid #ccc;
  display: block;
  margin: 0.5rem auto; }

.cmp-tilelist-id {
  color: #757575;
  font-size: 0.875rem;
  padding: 0 0.05rem 0.15rem; }

.cmp-tilelist-info {
  padding: 0.5rem 1rem; }

.cmp-tilelist-inlineform {
  display: inline-block; }

.cmp-tilelist-pricesub {
  color: #757575;
  font-size: 0.875rem; }

.cmp-tilelist-pricetext {
  display: inline-block; }

.cmp-tilelist-linkwrapper {
  text-decoration: none; }

.cmp-tilelist-rating {
  color: #555;
  margin: 0; }

.cmp-tilelist-value {
  padding: 0.25rem 0; }
  .cmp-tilelist-value:not(.untrimmed) {
    overflow: hidden;
    text-overflow: ellipsis;
    white-space: nowrap; }

.cmp-tilelist-valueicon {
  color: #757575;
  display: inline-block;
  font-size: 1.5rem;
  text-align: center;
  vertical-align: middle;
  width: 1.5rem; }

.cmp-tilelist-valuelabel {
  color: #757575;
  font-size: 0.875rem; }

.cmp-tilelist-wrapper {
  position: relative;
  width: 100%;
  overflow: hidden; }
  .cmp-tilelist-wrapper.image {
    background-clip: content-box;
    background-position: center center;
    background-repeat: no-repeat;
    background-size: cover;
    height: 7.5rem; }

.cmp-tilelist {
  position: relative;
  gap: 1rem;
  min-height: 100%; }

.cmp-tilelist-button {
  bottom: -1.7rem;
  height: 3.375rem;
  position: absolute;
  right: 1.7rem; }
  .cmp-tilelist-button i {
    padding: 0.4rem; }

.cmp-tilelist-clickablearea {
  bottom: 0;
  cursor: pointer;
  left: 12.5%;
  position: absolute;
  right: 12.5%;
  top: 0;
  z-index: 103; }

.cmp-tilelist-imgerrorplaceholder {
  position: absolute;
  top: 50%;
  left: 50%;
  -ms-transform: translate(-50%, -50%);
      transform: translate(-50%, -50%);
  color: #fefefe;
  text-align: center;
  z-index: 101; }

.cmp-tilelist-infogrid {
  padding-top: 0.5rem;
  width: 100%; }
  .cmp-tilelist-infogrid .cell {
    padding-right: 0.25rem; }

.cmp-tilelist-infoautoconfirm {
  color: #66c17b; }

.cmp-tilelist-infopublished {
  color: #66c17b; }

.cmp-tilelist-infounclaimed {
  color: #ffae00; }

.cmp-tilelist-infounpublished {
  color: #cc4b37; }

.cmp-tilelist-iconinstant {
  font-size: 1.25rem; }

.cmp-tilelist-name {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap; }

.cmp-tilelist-pricetext {
  white-space: nowrap;
  position: relative;
  top: -0.25rem; }

.cmp-tilelist-ratingandpricewrapper {
  gap: 0.25rem;
  -ms-flex-pack: justify;
      justify-content: space-between;
  -ms-flex-align: center;
      align-items: center;
  -ms-flex-wrap: wrap-reverse;
      flex-wrap: wrap-reverse; }

.cmp-tilelist-ratingwrapper {
  -ms-flex-wrap: nowrap;
      flex-wrap: nowrap; }

.cmp-tilelist-overlay {
  color: #fefefe;
  height: 100%;
  padding-top: 37.5%;
  position: absolute;
  text-align: center;
  top: 0;
  bottom: 0;
  left: 0;
  right: 0;
  width: 100%;
  z-index: 105; }
  .cmp-tilelist-overlay.dark {
    background-color: rgba(0, 0, 0, 0.8); }
  .cmp-tilelist-overlay.light {
    background-color: rgba(0, 0, 0, 0.35);
    height: calc(100% - 2.4rem);
    padding-top: calc(37.5% - 1.2rem); }
  .cmp-tilelist-overlay .button {
    margin-bottom: 0.25rem;
    margin-top: 0.25rem; }
  .cmp-tilelist-overlay .cmp-tilelist-overlay-content {
    padding: 0 1rem;
    -ms-transform: translateY(-50%);
        transform: translateY(-50%); }

.cmp-tilelist-tag {
  background-color: #fefefe;
  border-radius: 0.5rem;
  border: 1px solid #757575;
  color: #757575;
  display: inline-block;
  font-size: 0.875rem;
  padding: 0.25rem 0.5rem;
  margin: 0.1rem; }

.cmp-tilelist-tag {
  border: none; }

.cmp-tilelist-tagicon {
  padding-bottom: 0.1rem; }

.cmp-tilelist-tagsvg {
  height: 1rem;
  position: relative;
  top: -0.05rem;
  width: 1rem; }

.cmp-tilelist-tagwrapper {
  left: 0.4rem;
  position: absolute;
  right: 3rem;
  top: 0.4rem;
  z-index: 104; }

.cmp-tilelist-title {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap;
  padding: 0.25rem 0; }

.cmp-tilelist-warning {
  background-color: #cc4b37;
  color: #fefefe;
  padding: 0.5rem 0.75rem;
  position: absolute;
  text-align: left;
  top: 0;
  left: 0;
  right: 0;
  width: 100%;
  z-index: 106; }

.cmp-tilelist-wishlist {
  color: #fefefe;
  cursor: pointer;
  right: 0;
  padding: 0.6rem 0.75rem 0.4rem 0.75rem;
  position: absolute;
  top: 0;
  z-index: 103; }
  .cmp-tilelist-wishlist a {
    color: #fefefe; }
  .cmp-tilelist-wishlist i {
    font-size: 1.35rem;
    margin: 0;
    color: #fefefe; }
    .cmp-tilelist-wishlist i:hover {
      color: rgba(254, 254, 254, 0.95); }
  .cmp-tilelist-wishlist .dropdown-pane {
    left: -7.25rem !important; }

.cmp-tilelist-wrapper.carousel {
  padding-top: 75%; }

.cmp-tilelist-wrapper.image {
  height: 12rem; }
  @media only screen and (min-width: 1280px) {
    .cmp-tilelist-wrapper.image {
      height: 14.5rem; } }

.cmp-tilelist-wrapper.image.compact {
  height: 8rem; }

.card {
  overflow: visible; }

.cmp-tileplan-actions {
  margin-top: auto; }
  .cmp-tileplan-actions .button {
    margin: 0.125rem;
    padding: 0.55rem 0.7rem 0.5rem !important; }

.cmp-tileplan-avatar {
  aspect-ratio: 1/1;
  height: 3rem;
  border-radius: 50%; }

.cmp-tileplan-arrow {
  color: transparent;
  cursor: pointer;
  outline-color: transparent;
  position: absolute;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%); }
  .cmp-tileplan-arrow:before {
    color: #fefefe;
    font-family: FontAwesome;
    font-size: 3.5rem;
    font-weight: normal;
    opacity: 0.75;
    padding: 0 1.15rem; }
  .cmp-tileplan-arrow.left {
    left: 0; }
    .cmp-tileplan-arrow.left:before {
      content: "\f104"; }
  .cmp-tileplan-arrow.right {
    right: 0; }
    .cmp-tileplan-arrow.right:before {
      content: "\f105"; }

.cmp-tileplan-carousel {
  height: 100%;
  position: absolute;
  top: 0;
  bottom: 0;
  left: 0;
  right: 0;
  width: auto; }
  .cmp-tileplan-carousel .cmp-tileplan-carouselfirst {
    background-color: #333;
    height: 100%;
    overflow: hidden;
    text-align: center; }
  .cmp-tileplan-carousel img {
    height: 100%;
    margin: 0 auto;
    max-width: none; }
    .cmp-tileplan-carousel img:not([src]) {
      display: none; }

.cmp-tileplan-basicinfowrapper {
  column-gap: 0.75rem;
  row-gap: 0.25rem; }
  .cmp-tileplan-basicinfowrapper:not(:empty) {
    margin-top: 0.75rem;
    margin-bottom: 0.5rem; }

.cmp-tileplan-contentcontainer {
  row-gap: 0.75rem; }
  .cmp-tileplan-contentcontainer i {
    font-size: 0.875rem; }

.cmp-tileplan-divider {
  border-bottom: 1px solid #ccc;
  display: block;
  margin: 0.5rem auto; }

.cmp-tileplan-id {
  color: #757575;
  font-size: 0.875rem;
  padding: 0 0.05rem 0.15rem; }

.cmp-tileplan-info {
  padding: 0.5rem 1rem; }

.cmp-tileplan-inlineform {
  display: inline-block; }

.cmp-tileplan-pricesub {
  color: #757575;
  font-size: 0.875rem; }

.cmp-tileplan-pricetext {
  display: inline-block; }

.cmp-tileplan-linkwrapper {
  text-decoration: none; }

.cmp-tileplan-rating {
  color: #555;
  margin: 0; }

.cmp-tileplan-value {
  padding: 0.25rem 0; }
  .cmp-tileplan-value:not(.untrimmed) {
    overflow: hidden;
    text-overflow: ellipsis;
    white-space: nowrap; }

.cmp-tileplan-valueicon {
  color: #757575;
  display: inline-block;
  font-size: 1.5rem;
  text-align: center;
  vertical-align: middle;
  width: 1.5rem; }

.cmp-tileplan-valuelabel {
  color: #757575;
  font-size: 0.875rem; }

.cmp-tileplan-wrapper {
  position: relative;
  width: 100%;
  overflow: hidden; }
  .cmp-tileplan-wrapper.image {
    background-clip: content-box;
    background-position: center center;
    background-repeat: no-repeat;
    background-size: cover;
    height: 7.5rem; }

.cmp-tilerecon {
  -ms-flex-pack: justify;
      justify-content: space-between;
  clear: none !important; }
  .cmp-tilerecon.disabled {
    opacity: 0.25; }

.cmp-tilerecon-added {
  left: 0;
  position: absolute;
  right: 0;
  text-align: center;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%);
  z-index: 107; }

.cmp-tilerecon-addedicon {
  color: #fefefe;
  font-size: 6rem; }

.cmp-tilerecon-actions {
  padding-top: 0.5rem; }

.cmp-tilerecon-book {
  border-bottom: 1px solid #e3e3e3;
  position: relative; }
  .cmp-tilerecon-book .button {
    font-size: 0.875rem;
    padding: 0.55rem 0.7rem 0.5rem !important;
    position: absolute;
    right: 0;
    top: 0.6rem; }

.cmp-tilerecon-bookprice {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap;
  padding-bottom: 1.25rem; }

.cmp-tilerecon-info {
  padding-bottom: 0.75rem;
  padding-top: 0.75rem; }

.cmp-tilerecon-intro {
  padding: 0.75rem 1rem; }

.cmp-tilerecon-reordericon {
  cursor: grab; }

.cmp-tilerecon-selected {
  background-color: #fbe4df;
  border-radius: 2px;
  color: #e75635;
  display: inline-block;
  font-size: 0.875rem;
  padding: 0.15rem 0.5rem;
  margin: 0.1rem; }

.cmp-tilerecon-tag {
  background-color: #e7e7e7;
  border-radius: 2px;
  color: #aaa;
  display: inline-block;
  font-size: 0.875rem;
  padding: 0.15rem 0.5rem;
  margin: 0.1rem; }

.cmp-tilerecon-revealcontentheader {
  margin-bottom: 1rem; }

.cmp-tilerecon-confirmedbadge {
  background-color: #66c17b;
  border-radius: 0.5rem;
  color: #fefefe;
  display: inline-block;
  font-size: 0.875rem;
  padding: 0.25rem 0.5rem;
  margin: 0.1rem; }

.cmp-tilerecon-staffpickbadge {
  background-color: #66c17b;
  border-radius: 0.5rem;
  color: #fefefe;
  display: inline-block;
  font-size: 0.875rem;
  padding: 0.25rem 0.5rem;
  margin: 0.1rem; }

.cmp-tilerecon-staffpickbadge {
  position: absolute;
  right: 0; }

.cmp-tilerecon-contentcontainer {
  position: relative; }

.cmp-tilerecon-title {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap;
  margin-bottom: 0.5rem; }

.cmp-tilerecon-value {
  border-bottom: 1px solid #e3e3e3;
  padding: 0.5rem 0; }
  .cmp-tilerecon-value.breakdown {
    position: relative;
    text-align: right; }
  .cmp-tilerecon-value.long {
    height: 4.5rem;
    white-space: normal; }

.cmp-tilerecon-valuelabel {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap;
  line-height: 1.55;
  left: 0;
  position: absolute;
  right: 5rem;
  text-align: left; }

.cmp-tilerecon-wrapper.carousel {
  padding-top: 12.5rem; }

.card {
  overflow: visible; }

.cmp-tilerfp-actions {
  margin-top: auto; }
  .cmp-tilerfp-actions .button {
    margin: 0.125rem;
    padding: 0.55rem 0.7rem 0.5rem !important; }

.cmp-tilerfp-avatar {
  aspect-ratio: 1/1;
  height: 3rem;
  border-radius: 50%; }

.cmp-tilerfp-arrow {
  color: transparent;
  cursor: pointer;
  outline-color: transparent;
  position: absolute;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%); }
  .cmp-tilerfp-arrow:before {
    color: #fefefe;
    font-family: FontAwesome;
    font-size: 3.5rem;
    font-weight: normal;
    opacity: 0.75;
    padding: 0 1.15rem; }
  .cmp-tilerfp-arrow.left {
    left: 0; }
    .cmp-tilerfp-arrow.left:before {
      content: "\f104"; }
  .cmp-tilerfp-arrow.right {
    right: 0; }
    .cmp-tilerfp-arrow.right:before {
      content: "\f105"; }

.cmp-tilerfp-carousel {
  height: 100%;
  position: absolute;
  top: 0;
  bottom: 0;
  left: 0;
  right: 0;
  width: auto; }
  .cmp-tilerfp-carousel .cmp-tilerfp-carouselfirst {
    background-color: #333;
    height: 100%;
    overflow: hidden;
    text-align: center; }
  .cmp-tilerfp-carousel img {
    height: 100%;
    margin: 0 auto;
    max-width: none; }
    .cmp-tilerfp-carousel img:not([src]) {
      display: none; }

.cmp-tilerfp-basicinfowrapper {
  column-gap: 0.75rem;
  row-gap: 0.25rem; }
  .cmp-tilerfp-basicinfowrapper:not(:empty) {
    margin-top: 0.75rem;
    margin-bottom: 0.5rem; }

.cmp-tilerfp-contentcontainer {
  row-gap: 0.75rem; }
  .cmp-tilerfp-contentcontainer i {
    font-size: 0.875rem; }

.cmp-tilerfp-divider {
  border-bottom: 1px solid #ccc;
  display: block;
  margin: 0.5rem auto; }

.cmp-tilerfp-id {
  color: #757575;
  font-size: 0.875rem;
  padding: 0 0.05rem 0.15rem; }

.cmp-tilerfp-info {
  padding: 0.5rem 1rem; }

.cmp-tilerfp-inlineform {
  display: inline-block; }

.cmp-tilerfp-pricesub {
  color: #757575;
  font-size: 0.875rem; }

.cmp-tilerfp-pricetext {
  display: inline-block; }

.cmp-tilerfp-linkwrapper {
  text-decoration: none; }

.cmp-tilerfp-rating {
  color: #555;
  margin: 0; }

.cmp-tilerfp-value {
  padding: 0.25rem 0; }
  .cmp-tilerfp-value:not(.untrimmed) {
    overflow: hidden;
    text-overflow: ellipsis;
    white-space: nowrap; }

.cmp-tilerfp-valueicon {
  color: #757575;
  display: inline-block;
  font-size: 1.5rem;
  text-align: center;
  vertical-align: middle;
  width: 1.5rem; }

.cmp-tilerfp-valuelabel {
  color: #757575;
  font-size: 0.875rem; }

.cmp-tilerfp-wrapper {
  position: relative;
  width: 100%;
  overflow: hidden; }
  .cmp-tilerfp-wrapper.image {
    background-clip: content-box;
    background-position: center center;
    background-repeat: no-repeat;
    background-size: cover;
    height: 7.5rem; }

.cmp-tilerfpitem {
  display: inline-block;
  margin: 0 0.625rem 1rem;
  vertical-align: top;
  width: 24rem; }

.cmp-tilerfpitem-actions {
  margin-top: 0.375rem; }

.cmp-tilerfpitem-attachementcount {
  position: absolute;
  right: 0.5rem;
  top: 0rem; }

.cmp-tilerfpitem-attachementicon {
  font-size: 1rem; }

.cmp-tilerfpitem-attachementwrapper {
  position: relative; }

.cmp-tilerfpitem-content {
  padding: 0.75rem 1.25rem; }
  .cmp-tilerfpitem-content.padded {
    left: 11rem;
    position: absolute;
    right: 0;
    top: 0; }

.cmp-tilerfpitem-image {
  background-repeat: no-repeat;
  background-position: center;
  background-size: cover;
  width: 100%;
  height: 8.25rem;
  position: relative;
  width: 11rem; }

.cmp-tilerfpitem-label {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap;
  color: #757575;
  font-size: 0.75rem;
  padding-bottom: 0.25rem;
  text-transform: uppercase; }

.cmp-tilerfpitem-text {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap; }

.cmp-tilerfpitem-title {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap; }

.cmp-tilerfpitem-wrapper {
  position: relative; }

.card {
  overflow: visible; }

.cmp-tileplaceshort-actions {
  margin-top: auto; }
  .cmp-tileplaceshort-actions .button {
    margin: 0.125rem;
    padding: 0.55rem 0.7rem 0.5rem !important; }

.cmp-tileplaceshort-avatar {
  aspect-ratio: 1/1;
  height: 3rem;
  border-radius: 50%; }

.cmp-tileplaceshort-arrow {
  color: transparent;
  cursor: pointer;
  outline-color: transparent;
  position: absolute;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%); }
  .cmp-tileplaceshort-arrow:before {
    color: #fefefe;
    font-family: FontAwesome;
    font-size: 3.5rem;
    font-weight: normal;
    opacity: 0.75;
    padding: 0 1.15rem; }
  .cmp-tileplaceshort-arrow.left {
    left: 0; }
    .cmp-tileplaceshort-arrow.left:before {
      content: "\f104"; }
  .cmp-tileplaceshort-arrow.right {
    right: 0; }
    .cmp-tileplaceshort-arrow.right:before {
      content: "\f105"; }

.cmp-tileplaceshort-carousel {
  height: 100%;
  position: absolute;
  top: 0;
  bottom: 0;
  left: 0;
  right: 0;
  width: auto; }
  .cmp-tileplaceshort-carousel .cmp-tileplaceshort-carouselfirst {
    background-color: #333;
    height: 100%;
    overflow: hidden;
    text-align: center; }
  .cmp-tileplaceshort-carousel img {
    height: 100%;
    margin: 0 auto;
    max-width: none; }
    .cmp-tileplaceshort-carousel img:not([src]) {
      display: none; }

.cmp-tileplaceshort-basicinfowrapper {
  column-gap: 0.75rem;
  row-gap: 0.25rem; }
  .cmp-tileplaceshort-basicinfowrapper:not(:empty) {
    margin-top: 0.75rem;
    margin-bottom: 0.5rem; }

.cmp-tileplaceshort-contentcontainer {
  row-gap: 0.75rem; }
  .cmp-tileplaceshort-contentcontainer i {
    font-size: 0.875rem; }

.cmp-tileplaceshort-divider {
  border-bottom: 1px solid #ccc;
  display: block;
  margin: 0.5rem auto; }

.cmp-tileplaceshort-id {
  color: #757575;
  font-size: 0.875rem;
  padding: 0 0.05rem 0.15rem; }

.cmp-tileplaceshort-info {
  padding: 0.5rem 1rem; }

.cmp-tileplaceshort-inlineform {
  display: inline-block; }

.cmp-tileplaceshort-pricesub {
  color: #757575;
  font-size: 0.875rem; }

.cmp-tileplaceshort-pricetext {
  display: inline-block; }

.cmp-tileplaceshort-linkwrapper {
  text-decoration: none; }

.cmp-tileplaceshort-rating {
  color: #555;
  margin: 0; }

.cmp-tileplaceshort-value {
  padding: 0.25rem 0; }
  .cmp-tileplaceshort-value:not(.untrimmed) {
    overflow: hidden;
    text-overflow: ellipsis;
    white-space: nowrap; }

.cmp-tileplaceshort-valueicon {
  color: #757575;
  display: inline-block;
  font-size: 1.5rem;
  text-align: center;
  vertical-align: middle;
  width: 1.5rem; }

.cmp-tileplaceshort-valuelabel {
  color: #757575;
  font-size: 0.875rem; }

.cmp-tileplaceshort-wrapper {
  position: relative;
  width: 100%;
  overflow: hidden; }
  .cmp-tileplaceshort-wrapper.image {
    background-clip: content-box;
    background-position: center center;
    background-repeat: no-repeat;
    background-size: cover;
    height: 7.5rem; }

.cmp-tileplaceshort.card-in-card .cmp-tileplaceshort-contentswrapper {
  padding: 0.75rem;
  -ms-flex-pack: start;
      justify-content: flex-start; }

.cmp-tileplaceshort-image {
  aspect-ratio: 1/1;
  object-fit: cover;
  width: 100%;
  height: 100%; }

.cmp-tileplaceshort-contentswrapper {
  padding: 1.5rem;
  -ms-flex-pack: center;
      justify-content: center; }

.card {
  overflow: visible; }

.cmp-tilespace-actions {
  margin-top: auto; }
  .cmp-tilespace-actions .button {
    margin: 0.125rem;
    padding: 0.55rem 0.7rem 0.5rem !important; }

.cmp-tilespace-avatar {
  aspect-ratio: 1/1;
  height: 3rem;
  border-radius: 50%; }

.cmp-tilespace-arrow {
  color: transparent;
  cursor: pointer;
  outline-color: transparent;
  position: absolute;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%); }
  .cmp-tilespace-arrow:before {
    color: #fefefe;
    font-family: FontAwesome;
    font-size: 3.5rem;
    font-weight: normal;
    opacity: 0.75;
    padding: 0 1.15rem; }
  .cmp-tilespace-arrow.left {
    left: 0; }
    .cmp-tilespace-arrow.left:before {
      content: "\f104"; }
  .cmp-tilespace-arrow.right {
    right: 0; }
    .cmp-tilespace-arrow.right:before {
      content: "\f105"; }

.cmp-tilespace-carousel {
  height: 100%;
  position: absolute;
  top: 0;
  bottom: 0;
  left: 0;
  right: 0;
  width: auto; }
  .cmp-tilespace-carousel .cmp-tilespace-carouselfirst {
    background-color: #333;
    height: 100%;
    overflow: hidden;
    text-align: center; }
  .cmp-tilespace-carousel img {
    height: 100%;
    margin: 0 auto;
    max-width: none; }
    .cmp-tilespace-carousel img:not([src]) {
      display: none; }

.cmp-tilespace-basicinfowrapper {
  column-gap: 0.75rem;
  row-gap: 0.25rem; }
  .cmp-tilespace-basicinfowrapper:not(:empty) {
    margin-top: 0.75rem;
    margin-bottom: 0.5rem; }

.cmp-tilespace-contentcontainer {
  row-gap: 0.75rem; }
  .cmp-tilespace-contentcontainer i {
    font-size: 0.875rem; }

.cmp-tilespace-divider {
  border-bottom: 1px solid #ccc;
  display: block;
  margin: 0.5rem auto; }

.cmp-tilespace-id {
  color: #757575;
  font-size: 0.875rem;
  padding: 0 0.05rem 0.15rem; }

.cmp-tilespace-info {
  padding: 0.5rem 1rem; }

.cmp-tilespace-inlineform {
  display: inline-block; }

.cmp-tilespace-pricesub {
  color: #757575;
  font-size: 0.875rem; }

.cmp-tilespace-pricetext {
  display: inline-block; }

.cmp-tilespace-linkwrapper {
  text-decoration: none; }

.cmp-tilespace-rating {
  color: #555;
  margin: 0; }

.cmp-tilespace-value {
  padding: 0.25rem 0; }
  .cmp-tilespace-value:not(.untrimmed) {
    overflow: hidden;
    text-overflow: ellipsis;
    white-space: nowrap; }

.cmp-tilespace-valueicon {
  color: #757575;
  display: inline-block;
  font-size: 1.5rem;
  text-align: center;
  vertical-align: middle;
  width: 1.5rem; }

.cmp-tilespace-valuelabel {
  color: #757575;
  font-size: 0.875rem; }

.cmp-tilespace-wrapper {
  position: relative;
  width: 100%;
  overflow: hidden; }
  .cmp-tilespace-wrapper.image {
    background-clip: content-box;
    background-position: center center;
    background-repeat: no-repeat;
    background-size: cover;
    height: 7.5rem; }

.cmp-tilespace-detail {
  color: #757575;
  margin-bottom: 0.75rem; }

.cmp-tilespace-title {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap;
  margin-bottom: 0.15rem; }

.cmp-tipsempty {
  margin-bottom: 2rem;
  margin-top: 2rem;
  text-align: center; }
  @media only screen and (min-width: 640px) {
    .cmp-tipsempty {
      margin-bottom: 6rem; } }
  @media only screen and (min-width: 960px) {
    .cmp-tipsempty {
      margin-bottom: 10rem; } }
  @media only screen and (min-width: 640px) {
    .cmp-tipsempty {
      margin-top: 6rem; } }
  @media only screen and (min-width: 960px) {
    .cmp-tipsempty {
      margin-top: 10rem; } }

.cmp-tipsempty-button {
  margin-top: 1.75rem;
  min-width: 12rem; }

@keyframes spinning {
  0% {
    transform: rotate(0deg); }
  100% {
    transform: rotate(359deg); } }

.cmp-tipsempty-icon {
  color: #ccc;
  font-size: 6rem;
  margin-bottom: 1.75rem; }
  .cmp-tipsempty-icon.rotate {
    animation: spinning 2s infinite ease 1.5s; }

.cmp-tipsempty-title {
  margin-bottom: 0.5rem; }

.cmp-tipsform {
  padding: 0.5rem 0.875rem;
  position: relative; }
  @media only screen and (min-width: 960px) {
    .cmp-tipsform {
      padding: 1rem 1.5rem; } }

.cmp-tipsform-button {
  margin-top: 0.25rem; }

.cmp-tipsform-image {
  height: 2rem;
  width: 2rem; }
  @media only screen and (min-width: 640px) {
    .cmp-tipsform-image {
      position: absolute; } }

.cmp-tipsform-icon {
  font-size: 2rem; }
  @media only screen and (min-width: 640px) {
    .cmp-tipsform-icon {
      position: absolute; } }
  @media only screen and (min-width: 640px) {
    .cmp-tipsform-icon {
      top: 50%; } }
  @media only screen and (min-width: 640px) {
    .cmp-tipsform-icon {
      -ms-transform: translateY(-50%);
          transform: translateY(-50%); } }

.cmp-tipsform-texts {
  margin: 0.25rem 0; }
  @media only screen and (min-width: 640px) {
    .cmp-tipsform-texts {
      margin: 0.25rem 0 0.25rem 3rem; } }

.cmp-tipsform-title {
  margin-bottom: 0.25rem; }

.cmp-tipsform {
  background-color: rgba(170, 170, 170, 0.1);
  margin: 1rem 0; }

.cmp-tagupgrade {
  background-color: #b87af5;
  border-radius: 2px;
  color: #fefefe;
  display: inline-block;
  font-size: 0.875rem;
  font-weight: bold;
  padding: 0.15rem 0.5rem;
  margin: 0.1rem;
  text-transform: uppercase; }

.cmp-uploadphoto-explanation {
  margin-bottom: 1rem; }

.cmp-uploadphoto-image {
  background-color: #fefefe;
  background-position: center;
  background-repeat: no-repeat;
  background-size: cover;
  border-radius: 50%;
  height: 10rem;
  margin: 0 auto;
  width: 10rem; }

.cmp-uploadphoto-input {
  margin-bottom: 1rem; }
  .cmp-uploadphoto-input label {
    background-color: #eee;
    border-radius: 50%;
    height: 10rem;
    margin: 0 auto;
    width: 10rem; }
    .cmp-uploadphoto-input label i {
      font-size: 3rem;
      line-height: 4.5rem;
      position: relative;
      top: 3rem; }
  .cmp-uploadphoto-input span {
    display: block; }
  .cmp-uploadphoto-input input {
    display: none; }

.cmp-upsellingbanner {
  padding: 1rem 1.5rem; }
  @media only screen and (min-width: 640px) {
    .cmp-upsellingbanner {
      padding: 1.75rem 2.625rem; } }
  .cmp-upsellingbanner.organization {
    background-color: #f7f1ff; }
  .cmp-upsellingbanner.secondary {
    background-color: #f1f8fd; }

.cmp-upsellingbanner-action {
  margin-top: 1.5rem; }

.cmp-upsellingbanner-comment {
  margin-top: 0.5rem; }
  .cmp-upsellingbanner-comment a {
    padding-left: 0.5rem; }

.cmp-upsellingbanner-content {
  padding-right: 1rem; }
  @media only screen and (min-width: 640px) {
    .cmp-upsellingbanner-content {
      -ms-flex-order: 1;
          order: 1; } }

@media only screen and (min-width: 640px) {
  .cmp-upsellingbanner-image {
    -ms-flex-order: 2;
        order: 2; } }

.cmp-upsellingbanner-title {
  margin-bottom: 0.5rem; }

.cmp-userrow.row {
  border-bottom: 1px solid #ccc; }
  .cmp-userrow.row:last-child {
    border-bottom: none; }
  .cmp-userrow.row > .column, .cmp-userrow.row > .columns {
    padding-top: 1rem;
    padding-bottom: 1rem;
    position: relative; }

.cmp-userrow-link {
  padding-right: 0.5rem; }

.cmp-userrow-user {
  position: relative; }

.cmp-userrow-usericon, .cmp-userrow-userpicture {
  font-size: 1.25rem;
  height: 2.4rem;
  padding: 0.3rem 0;
  position: absolute;
  top: 0;
  width: 2.4rem; }

.cmp-userrow-usericon {
  border-radius: 50%;
  color: #fefefe;
  margin: 0 auto;
  text-align: center; }
  .cmp-userrow-usericon:empty:after {
    content: "\f007";
    font-family: "FontAwesome"; }

.cmp-userrow-userpicture {
  background-color: #fefefe;
  background-position: center;
  background-repeat: no-repeat;
  background-size: cover;
  border-radius: 50%; }

@media only screen and (min-width: 640px) {
  .cmp-userrow-user ~ .cmp-userrow-text {
    margin-left: 3rem; } }

.cmp-userrow-text {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap;
  font-size: 0.875rem; }
  .cmp-userrow-text.gray {
    color: #757575; }
  .cmp-userrow-text + .cmp-userrow-text {
    margin-top: 0.1rem; }

.sb-content-toggle:hover {
  cursor: pointer; }

.sb-cover-container {
  background-repeat: no-repeat;
  background-position: center;
  background-size: cover;
  width: 100%; }

.sb-disabled-submission.disabled {
  pointer-events: none;
  opacity: 0.25; }

.sb-empty-select {
  color: #aaa;
  font-weight: normal; }
  .sb-empty-select option {
    color: #333; }

.sb-header-slider {
  transition: all 2000ms;
  -webkit-perspective: 1000;
  -webkit-backface-visibility: hidden;
  background-color: #333; }

.sb-high-value-user::before {
  content: "\f06d";
  font-family: FontAwesome;
  padding: 0.2rem; }

.sb-loading-content {
  cursor: wait !important;
  opacity: 0.2; }

.sb-open-lightbox {
  cursor: pointer; }

.sb-range-high {
  background-color: #66c17b; }
  .sb-range-high.sb-range-reverse {
    background-color: #cc4b37; }

.sb-range-low {
  background-color: #cc4b37; }
  .sb-range-low.sb-range-reverse {
    background-color: #66c17b; }

.sb-range-mid {
  background-color: #ffda17; }

.sb-saving.cmp-spinningcircle {
  display: inline-block; }

.sb-waypoint-fixed {
  position: fixed !important;
  top: 1rem !important;
  width: 320px; }

.sb-widgetcalendar-setcheckin .sb-widgetcalendar-slot:not(.closed):not(.past):not(.sb-widgetcalendar-beforecheckin), .sb-widgetcalendar-setcheckout .sb-widgetcalendar-slot:not(.closed):not(.past):not(.sb-widgetcalendar-beforecheckin) {
  cursor: pointer; }

.sb-widgetcalendar-setcheckin .sb-widgetcalendar-slot.sb-widgetcalendar-beforecheckin, .sb-widgetcalendar-setcheckin .sb-widgetcalendar-slot.closed, .sb-widgetcalendar-setcheckin .sb-widgetcalendar-slot.past, .sb-widgetcalendar-setcheckout .sb-widgetcalendar-slot.sb-widgetcalendar-beforecheckin, .sb-widgetcalendar-setcheckout .sb-widgetcalendar-slot.closed, .sb-widgetcalendar-setcheckout .sb-widgetcalendar-slot.past {
  cursor: not-allowed; }

.sb-widgetcalendar-setcheckin .sb-widgetcalendar-tabcheckin {
  border-bottom: 2px solid #e75635 !important; }

.sb-widgetcalendar-setcheckout .sb-widgetcalendar-tabcheckout {
  border-bottom: 2px solid #e75635 !important; }

.autocomplete-suggestion {
  padding: 0.4rem 0.8rem; }
  .autocomplete-suggestion::before {
    color: #aaa;
    font-family: Lato, Helvetica, Arial, sans-serif;
    font-size: 0.875rem;
    padding-right: 0.2rem; }
  .autocomplete-suggestion:hover {
    background-color: #f0f0f0; }
  .autocomplete-suggestion.address b, .autocomplete-suggestion.districts b, .autocomplete-suggestion.locations b, .autocomplete-suggestion.spaces b, .autocomplete-suggestion.venues b {
    color: #333; }
  .autocomplete-suggestion.address::before, .autocomplete-suggestion.districts::before, .autocomplete-suggestion.locations::before, .autocomplete-suggestion.spaces::before, .autocomplete-suggestion.venues::before {
    font-family: "FontAwesome";
    padding-right: 0.5rem; }
  .autocomplete-suggestion.address::before, .autocomplete-suggestion.districts::before, .autocomplete-suggestion.locations::before {
    content: "\f041"; }
  .autocomplete-suggestion.search b {
    color: #333; }
  .autocomplete-suggestion.spaces::before, .autocomplete-suggestion.venues::before {
    content: "\f0f7"; }

.autocomplete-suggestions {
  border: none;
  cursor: pointer;
  margin-top: 0.2rem;
  z-index: 400; }

.fc .fc-scrollgrid-section > .fc-timegrid-divider {
  background-color: #757575;
  border-style: none; }

.fc .fc-timeline-slot-cushion {
  color: #333; }

.fc .fc-toolbar.fc-header-toolbar {
  margin: 1.25rem 0; }

.fc .fc-toolbar .fc-button {
  background-color: transparent;
  border: none;
  color: #555; }
  .fc .fc-toolbar .fc-button:focus {
    box-shadow: none;
    outline-color: transparent; }
  .fc .fc-toolbar .fc-button:active {
    background-color: transparent;
    border: none;
    color: #e3e3e3; }

.fc .fc-toolbar-title {
  display: inline-block;
  font-size: 1.25rem;
  position: relative;
  padding: 0 1rem;
  top: 0.3rem; }

.fc-col-header th {
  border-left: none;
  border-right: none;
  border-top: none;
  padding: 0.5rem 0; }

.fc-col-header-cell-cushion {
  text-decoration: none;
  color: #555;
  font-size: 1.25rem;
  font-weight: normal; }
  .fc-col-header-cell-cushion small {
    color: black;
    display: none;
    font-size: 0.875rem;
    margin-left: 0.25rem;
    text-transform: uppercase; }
    @media only screen and (min-width: 960px) {
      .fc-col-header-cell-cushion small {
        display: inline-block; } }
  .fc-col-header-cell-cushion:hover {
    color: #555; }

.fc-theme-standard .fc-scrollgrid {
  border: none; }

.fc-theme-standard td {
  border-right: none; }

.fc-theme-standard .fc-scrollgrid-section-body > td {
  border-bottom: none; }

.fc-timegrid-event .fc-event-main {
  padding: 0.125rem 0.325rem; }

.fc-v-event {
  border-color: #fefefe;
  color: #555; }
  .fc-v-event:hover {
    color: #e3e3e3; }

.fc-v-event .fc-event-main {
  color: inherit; }

.iti {
  display: block; }

.irs--flat .irs-bar {
  background-color: #aaa; }

.irs--flat .irs-line {
  background-color: #eee; }

.irs--flat .irs-from, .irs--flat .irs-to, .irs--flat .irs-single {
  background-color: #333; }

.irs--flat .irs-from:before, .irs--flat .irs-to:before, .irs--flat .irs-single:before {
  border-top-color: #333; }

.irs--flat .irs-handle > i:first-child {
  background-color: #333; }

.irs--flat .irs-handle.state_hover > i:first-child, .irs--flat .irs-handle:hover > i:first-child {
  background-color: #aaa; }

.leaflet-map-pane canvas {
  z-index: 301; }

.leaflet-map-pane svg {
  z-index: 302; }

.leaflet-tile-pane {
  z-index: 302; }

.leaflet-pane {
  z-index: 303; }

.leaflet-overlay-pane {
  z-index: 303; }

.leaflet-shadow-pane {
  z-index: 304; }

.leaflet-marker-pane {
  z-index: 305; }

.leaflet-tooltip-pane {
  z-index: 306; }

.leaflet-popup-pane {
  z-index: 307; }

.leaflet-zoom-box {
  z-index: 308; }

.leaflet-control {
  z-index: 308; }

.leaflet-top, .leaflet-bottom {
  z-index: 309; }

#lg-outer {
  background-color: rgba(0, 0, 0, 0.8); }

#lg-gallery .thumb-cont .thumb-info {
  background-color: transparent; }

#lg-slider .lg-slide img {
  max-height: 95%;
  max-width: 95%; }
  @media only screen and (min-width: 960px) {
    #lg-slider .lg-slide img {
      max-height: 85%; } }
  @media only screen and (min-width: 960px) {
    #lg-slider .lg-slide img {
      max-width: 85%; } }

#lg-action {
  position: static; }
  #lg-action a {
    background-color: transparent;
    font-size: 24px;
    margin-top: -12px !important;
    position: absolute;
    top: 55%;
    z-index: 999; }
    @media only screen and (min-width: 960px) {
      #lg-action a {
        font-size: 40px; } }
    @media only screen and (min-width: 960px) {
      #lg-action a {
        margin-top: -20px !important; } }
    #lg-action a:hover {
      background-color: transparent; }
    #lg-action a#lg-prev {
      left: -32px; }
      @media only screen and (min-width: 960px) {
        #lg-action a#lg-prev {
          left: -26px; } }
      #lg-action a#lg-prev:before {
        padding: 1.75rem; }
        @media only screen and (min-width: 960px) {
          #lg-action a#lg-prev:before {
            padding: 6.125rem 1.75rem; } }
    #lg-action a#lg-next {
      right: 30px; }
      @media only screen and (min-width: 960px) {
        #lg-action a#lg-next {
          right: 54px; } }
      #lg-action a#lg-next:after {
        padding: 1.75rem; }
        @media only screen and (min-width: 960px) {
          #lg-action a#lg-next:after {
            padding: 6.125rem 1.75rem; } }

#lg-close {
  background-color: transparent; }
  #lg-close:after {
    font-size: 20px; }
    @media only screen and (min-width: 960px) {
      #lg-close:after {
        font-size: 30px; } }

.nvd3 text {
  font-family: inherit; }

.slick-slide img {
  max-width: none; }

.StripeElement {
  box-shadow: 0 1px 3px 0 #eff2f5;
  height: 40px;
  padding: 10px 12px; }

.StripeElement--focus {
  box-shadow: 0 1px 3px 0 #cfd7df; }

.StripeElement--invalid {
  border-color: #fa755a; }

.StripeElement--webkit-autofill {
  background-color: #fefde5 !important; }

.pag-accounts {
  background-color: #f7f7f7;
  background-repeat: no-repeat;
  background-position: center center;
  background-attachment: fixed;
  background-size: cover; }
  .pag-accounts .lyt-footer {
    margin-top: 4rem; }
    @media only screen and (min-width: 960px) {
      .pag-accounts .lyt-footer {
        margin-top: 8rem; } }

.pag-accounts-actions i {
  font-size: 5rem;
  margin: 1rem;
  text-align: center; }

.pag-accounts-actionsbutton {
  margin-top: 0.25rem; }

.pag-accounts-actionstext {
  margin-top: 0.5rem; }

.pag-accounts-actionstitle {
  margin-bottom: 0.25rem; }

.pag-accounts-bookingfrequency {
  margin-top: 1rem;
  margin-bottom: 1.5rem; }

.pag-accounts-feedback {
  padding-top: 0.75rem;
  text-align: center; }
  @media only screen and (min-width: 640px) {
    .pag-accounts-feedback {
      padding-top: 1.25rem; } }

.pag-accounts-feedbackicon.fa {
  font-size: 4rem;
  margin-bottom: 2rem; }

.pag-accounts-feedbackintro {
  margin: 0.5rem 0; }

.pag-accounts-field {
  margin-bottom: 0.5rem; }

.pag-accounts-form {
  padding-top: 0.75rem; }
  @media only screen and (min-width: 640px) {
    .pag-accounts-form {
      padding-top: 1.25rem; } }

.pag-accounts-intro {
  position: relative; }

.pag-accounts-introcomment {
  font-size: 0.875rem;
  margin-right: 0.5rem; }

.pag-accounts-intropoint {
  border-radius: 50%;
  display: inline-block;
  height: 1.5rem;
  padding: 0;
  position: relative;
  text-align: center;
  top: -0.05rem;
  width: 1.5rem; }
  .pag-accounts-intropoint:first-child {
    margin-left: 0; }
  .pag-accounts-intropoint.current, .pag-accounts-intropoint.done {
    background-color: #757575;
    color: #fefefe; }
  .pag-accounts-intropoint.next {
    border: 1px solid #757575;
    color: #757575; }

.pag-accounts-introsteps {
  margin-bottom: 1rem; }
  .pag-accounts-introsteps hr {
    border-bottom: 1px solid #757575;
    display: inline-block;
    width: 1rem; }

.pag-accounts-introtitle {
  display: inline-block;
  margin-bottom: 0.25rem;
  margin-right: 0.5rem; }

.pag-accounts-logo {
  display: block;
  margin-bottom: 0.7rem;
  opacity: 0.75;
  text-align: center; }
  @media only screen and (min-width: 640px) {
    .pag-accounts-logo {
      margin-bottom: 1rem; } }
  .pag-accounts-logo img {
    max-width: 7rem; }
    @media only screen and (min-width: 640px) {
      .pag-accounts-logo img {
        max-width: 10rem; } }

.pag-accounts-forgot {
  position: relative;
  text-align: right;
  top: -0.5rem; }

.pag-accounts-legaltext {
  color: #757575;
  font-size: 0.875rem;
  margin-top: 0.5rem;
  text-align: left; }
  .pag-accounts-legaltext a {
    font-size: 0.875rem; }

.pag-accounts-newsletter {
  margin: 1rem 0 0.5rem; }

.pag-accounts-socialgrid {
  gap: 0.75rem; }

.pag-accounts-sociallabel {
  margin-bottom: 0.125rem; }

.pag-accounts-wrapper {
  margin: 0 auto;
  max-width: 24.25rem;
  padding: 0.875rem; }
  @media only screen and (min-width: 640px) {
    .pag-accounts-wrapper {
      max-width: 37.5rem; } }
  @media only screen and (min-width: 640px) {
    .pag-accounts-wrapper {
      padding: 2.5rem 0 0 0; } }
  @media only screen and (min-width: 1280px) {
    .pag-accounts-wrapper {
      padding: 5rem 0 0 0; } }
  .pag-accounts-wrapper .card {
    padding: 0.875rem; }
    @media only screen and (min-width: 640px) {
      .pag-accounts-wrapper .card {
        padding: 1.5rem 2.25rem; } }

.pag-api-comment {
  padding: 0.5rem 0; }

.pag-api-form {
  margin: 5rem auto 10rem;
  padding: 1rem 1.5rem; }

.pag-api-title {
  margin-bottom: 0.5rem; }

.pag-calendar .fc-timegrid-axis, .pag-calendar .fc-timegrid-slot-minor:first-child {
  background-color: #f0f8fd; }

.pag-calendar .fc-theme-standard .fc-scrollgrid {
  border-left: 5px solid #50aaeb; }

.pag-calendar .fc-icon-fontawesome {
  font-family: FontAwesome !important; }

.pag-calendar .fc .fc-button .fc-icon-fontawesome {
  font-size: 1.2em; }

.pag-calendar .sb-cal-action {
  cursor: pointer;
  display: inline-block;
  overflow-x: hidden; }

.pag-calendar .sb-cal-action.wait {
  cursor: wait; }

.pag-calendar .sb-cal-booked {
  background-color: #333; }
  .pag-calendar .sb-cal-booked.sb-cal-status-pending, .pag-calendar .sb-cal-booked.sb-cal-status-reserved, .pag-calendar .sb-cal-booked.sb-cal-status-reserved-pending {
    background-color: #e75635;
    color: #fefefe; }
  .pag-calendar .sb-cal-booked.sb-cal-status-confirmed {
    background-color: #333;
    color: #fefefe; }
    .pag-calendar .sb-cal-booked.sb-cal-status-confirmed.sb-cal-kind-org-own {
      background-color: #757575; }

.pag-calendar .sb-cal-blocked, .pag-calendar .sb-cal-closed {
  background-color: #eee;
  color: #333; }

.pag-calendar .sb-cal-dateclicked {
  z-index: 100 !important; }

.pag-calendar .sb-feedics-calendar-submit.wait {
  cursor: wait; }

.pag-calendar-attached {
  margin-bottom: 1.5rem;
  margin-top: 1.5rem; }

.pag-calendar-attachedlist {
  margin-left: 0.5rem; }
  .pag-calendar-attachedlist li {
    margin-top: 0.5rem; }

.pag-calendar-buttons .button {
  margin: 0.25rem; }

.pag-calendar-data {
  margin-bottom: 1rem; }
  @media only screen and (min-width: 640px) {
    .pag-calendar-data {
      position: relative; } }

.pag-calendar-explanation {
  margin-top: 1.5rem; }

.pag-calendar-help {
  background-color: #50aaeb;
  background-repeat: no-repeat;
  background-position: center center;
  background-attachment: scroll;
  background-size: cover;
  color: #fefefe;
  margin: 0 0 2rem;
  padding: 0.5rem 2rem; }
  .pag-calendar-help a {
    color: #fefefe;
    text-decoration: underline; }

.pag-calendar-helpbutton {
  display: block;
  margin-top: 0.25rem; }

.pag-calendar-helptext {
  margin-top: 0.25rem; }

.pag-calendar-helptitle {
  font-weight: bold; }

.pag-calendar-legend {
  margin-bottom: 1.5rem;
  position: relative; }

.pag-calendar-legendarea {
  margin: 0.5rem 0.5rem 1.5rem; }
  .pag-calendar-legendarea .row {
    margin-right: -0.5rem;
    margin-left: -0.5rem; }
    .pag-calendar-legendarea .row .column, .pag-calendar-legendarea .row .columns {
      padding: 0.5rem;
      position: relative; }

input[type=checkbox].pag-calendar-legendcheckbox {
  border: 0;
  clip: rect(0 0 0 0);
  height: 1px;
  width: 1px;
  margin: -1px;
  overflow: hidden;
  padding: 0;
  position: absolute; }
  input[type=checkbox].pag-calendar-legendcheckbox ~ .pag-calendar-legendarea {
    display: none; }
  input[type=checkbox].pag-calendar-legendcheckbox:checked ~ .pag-calendar-legendarea {
    display: block; }
  input[type=checkbox].pag-calendar-legendcheckbox + .pag-calendar-legendlabel {
    color: #50aaeb;
    font-size: 0.875rem;
    padding-left: 0; }
    input[type=checkbox].pag-calendar-legendcheckbox + .pag-calendar-legendlabel:hover {
      color: #95cbf3; }
    input[type=checkbox].pag-calendar-legendcheckbox + .pag-calendar-legendlabel:after {
      display: none; }
    input[type=checkbox].pag-calendar-legendcheckbox + .pag-calendar-legendlabel:before {
      display: none; }

.pag-calendar-line {
  display: -ms-flexbox;
  display: flex;
  -ms-flex-align: center;
      align-items: center; }

.pag-calendar-lineswatch {
  display: inline-block;
  height: 1.05rem;
  margin-right: 0.5rem;
  width: 1.05rem; }

.pag-calendar-linetext {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap;
  background-color: transparent;
  color: #333;
  display: inline-block;
  max-width: 20rem;
  margin-right: 1rem; }

.pag-calendar-lineupdated {
  margin-right: 1rem; }

.pag-calendar-name {
  font-size: 1.25rem;
  margin-top: 1rem; }
  @media only screen and (min-width: 640px) {
    .pag-calendar-name {
      margin-top: 0; } }
  @media only screen and (min-width: 640px) {
    .pag-calendar-name {
      left: 0; } }
  @media only screen and (min-width: 640px) {
    .pag-calendar-name {
      position: absolute; } }
  @media only screen and (min-width: 640px) {
    .pag-calendar-name {
      top: 1.75rem; } }
  @media only screen and (min-width: 640px) {
    .pag-calendar-name {
      width: 10rem; } }

.pag-calendar-section {
  margin-bottom: 2rem;
  margin-top: 0.25rem;
  padding: 0.75rem; }
  @media only screen and (min-width: 640px) {
    .pag-calendar-section {
      padding: 1.25rem; } }

.pag-calendar-swatch {
  border: 1px solid #ddd;
  display: inline-block;
  height: 1rem;
  position: absolute;
  width: 1rem; }
  .pag-calendar-swatch.available {
    background-color: #fefefe; }
  .pag-calendar-swatch.pending {
    background-color: #e75635;
    border: 1px solid #e75635; }
  .pag-calendar-swatch.confirmed-std-ext {
    background-color: #333;
    border: 1px solid #333; }
  .pag-calendar-swatch.confirmed-org-own {
    background-color: #757575;
    border: 1px solid #757575; }
  .pag-calendar-swatch.closed {
    background-color: #eee; }

.pag-calendar-text {
  font-size: 0.875rem;
  margin-left: 2rem; }

.pag-calendar-title {
  color: #757575; }

.pag-conversationdetail .lyt-sided {
  margin: 0.75rem auto 0;
  padding: 0 0.75rem; }
  @media only screen and (min-width: 960px) {
    .pag-conversationdetail .lyt-sided {
      margin: 1.25rem auto 0; } }
  @media only screen and (min-width: 640px) {
    .pag-conversationdetail .lyt-sided {
      max-width: 640px; } }
  @media only screen and (min-width: 960px) {
    .pag-conversationdetail .lyt-sided {
      max-width: 920px; } }
  @media only screen and (min-width: 1280px) {
    .pag-conversationdetail .lyt-sided {
      max-width: 960px; } }
  @media only screen and (min-width: 1600px) {
    .pag-conversationdetail .lyt-sided {
      max-width: 960px; } }
  @media only screen and (min-width: 640px) {
    .pag-conversationdetail .lyt-sided {
      padding: 0 20px; } }

@media only screen and (min-width: 960px) {
  .pag-conversationdetail .lyt-sided {
    position: relative; } }

@media only screen and (min-width: 960px) {
  .pag-conversationdetail .lyt-sided:after {
    content: ""; } }

@media only screen and (min-width: 960px) {
  .pag-conversationdetail .lyt-sided:after {
    display: table; } }

@media only screen and (min-width: 960px) {
  .pag-conversationdetail .lyt-sided:after {
    clear: both; } }

.pag-conversationdetail .lyt-sided .lyt-sided-aside {
  width: 100%; }
  @media only screen and (min-width: 960px) {
    .pag-conversationdetail .lyt-sided .lyt-sided-aside {
      float: right; } }
  @media only screen and (min-width: 960px) {
    .pag-conversationdetail .lyt-sided .lyt-sided-aside {
      width: 320px; } }
  .pag-conversationdetail .lyt-sided .lyt-sided-aside + .lyt-sided-main {
    margin-top: 2.5rem; }
    @media only screen and (min-width: 960px) {
      .pag-conversationdetail .lyt-sided .lyt-sided-aside + .lyt-sided-main {
        margin-top: 0; } }

.pag-conversationdetail .lyt-sided .lyt-sided-main {
  width: 100%; }
  @media only screen and (min-width: 960px) {
    .pag-conversationdetail .lyt-sided .lyt-sided-main {
      float: left; } }
  @media only screen and (min-width: 960px) {
    .pag-conversationdetail .lyt-sided .lyt-sided-main {
      width: 520px; } }
  @media only screen and (min-width: 1280px) {
    .pag-conversationdetail .lyt-sided .lyt-sided-main {
      width: 560px; } }
  @media only screen and (min-width: 1600px) {
    .pag-conversationdetail .lyt-sided .lyt-sided-main {
      width: 560px; } }
  .pag-conversationdetail .lyt-sided .lyt-sided-main + .lyt-sided-aside {
    margin-top: 2.5rem; }
    @media only screen and (min-width: 960px) {
      .pag-conversationdetail .lyt-sided .lyt-sided-main + .lyt-sided-aside {
        margin-top: 0; } }
    @media only screen and (min-width: 1280px) {
      .pag-conversationdetail .lyt-sided .lyt-sided-main + .lyt-sided-aside .lyt-sided-aside-fixed {
        position: fixed; } }
    @media only screen and (min-width: 1280px) {
      .pag-conversationdetail .lyt-sided .lyt-sided-main + .lyt-sided-aside .lyt-sided-aside-fixed {
        width: 320px; } }

.pag-conversationdetail .cmp-conversation-form {
  border-top: 1px solid #ccc;
  margin-top: 2rem;
  padding: 2rem 0 0; }

.pag-conversationdetail .cmp-orgupsellinglink {
  margin-top: 0; }

.pag-conversationdetail .cmp-tilebooking, .pag-conversationdetail .cmp-tilespace {
  margin-bottom: 1rem; }

.pag-conversationdetail-back {
  margin-bottom: 1rem; }
  .pag-conversationdetail-back i {
    position: relative;
    top: -0.05rem; }

.pag-conversationdetail-empty {
  padding: 1.25rem 0;
  text-align: center; }
  .pag-conversationdetail-empty i {
    display: block;
    font-size: 2.5rem;
    margin-bottom: 0.25rem; }

.pag-conversationdetail-intro {
  border-bottom: 1px solid #ccc;
  margin: 2rem 0;
  padding-bottom: 2rem; }

.pag-conversationdetail-link {
  margin-bottom: 0.6rem;
  margin-top: 0.75rem; }

.pag-conversationlist-legend > .row {
  border-bottom: 1px solid #ccc; }

.pag-conversationlist-legendicon {
  margin-right: 0.4rem;
  position: relative;
  top: 0.05rem; }

.pag-conversationlist-legendlink {
  text-transform: uppercase; }

.pag-conversationlist-legendsort {
  cursor: pointer; }

.pag-conversationlist-legendtext {
  color: #aaa;
  text-transform: uppercase; }

.pag-conversationlist-table {
  margin-bottom: 3rem;
  margin-top: 1.5rem; }
  @media only screen and (min-width: 640px) {
    .pag-conversationlist-table {
      min-width: 40rem; } }
  .pag-conversationlist-table > .row {
    border-bottom: 1px solid #ccc;
    position: relative; }
    .pag-conversationlist-table > .row:last-child {
      border-bottom: none; }
    .pag-conversationlist-table > .row > .column, .pag-conversationlist-table > .row > .columns {
      padding-top: 0.5rem;
      padding-bottom: 0.5rem; }
      @media only screen and (min-width: 640px) {
        .pag-conversationlist-table > .row > .column, .pag-conversationlist-table > .row > .columns {
          padding-top: 1rem; } }
      @media only screen and (min-width: 640px) {
        .pag-conversationlist-table > .row > .column, .pag-conversationlist-table > .row > .columns {
          padding-bottom: 1rem; } }

.pag-conversationlist-title {
  margin-bottom: 0.5rem;
  margin-right: 1rem;
  text-transform: uppercase; }
  @media only screen and (min-width: 640px) {
    .pag-conversationlist-title {
      display: inline-block; } }

.pag-conversationlist-action {
  margin-top: 1.5rem; }

.pag-conversationlist-content {
  margin-bottom: 3rem;
  margin-top: 1.5rem; }
  .pag-conversationlist-content.overlayed {
    opacity: 0.2;
    position: relative; }
  .pag-conversationlist-content.overlayed .pag-conversationlist-contentoverlay {
    bottom: 0;
    cursor: default;
    left: 0;
    position: absolute;
    right: 0;
    top: 0;
    z-index: 700; }

.pag-dashboardbookings-legend > .row {
  border-bottom: 1px solid #ccc; }

.pag-dashboardbookings-legendicon {
  margin-right: 0.4rem;
  position: relative;
  top: 0.05rem; }

.pag-dashboardbookings-legendlink {
  text-transform: uppercase; }

.pag-dashboardbookings-legendsort {
  cursor: pointer; }

.pag-dashboardbookings-legendtext {
  color: #aaa;
  text-transform: uppercase; }

.pag-dashboardbookings-table {
  margin-bottom: 3rem;
  margin-top: 1.5rem; }
  @media only screen and (min-width: 640px) {
    .pag-dashboardbookings-table {
      min-width: 40rem; } }
  .pag-dashboardbookings-table > .row {
    border-bottom: 1px solid #ccc;
    position: relative; }
    .pag-dashboardbookings-table > .row:last-child {
      border-bottom: none; }
    .pag-dashboardbookings-table > .row > .column, .pag-dashboardbookings-table > .row > .columns {
      padding-top: 0.5rem;
      padding-bottom: 0.5rem; }
      @media only screen and (min-width: 640px) {
        .pag-dashboardbookings-table > .row > .column, .pag-dashboardbookings-table > .row > .columns {
          padding-top: 1rem; } }
      @media only screen and (min-width: 640px) {
        .pag-dashboardbookings-table > .row > .column, .pag-dashboardbookings-table > .row > .columns {
          padding-bottom: 1rem; } }

.pag-dashboardbookings-title {
  margin-bottom: 0.5rem;
  margin-right: 1rem;
  text-transform: uppercase; }
  @media only screen and (min-width: 640px) {
    .pag-dashboardbookings-title {
      display: inline-block; } }

@media only screen and (min-width: 640px) {
  .pag-dashboardbookings .cmp-bookingexport {
    right: 0; } }

@media only screen and (min-width: 640px) {
  .pag-dashboardbookings .cmp-bookingexport {
    position: absolute; } }

@media only screen and (min-width: 640px) {
  .pag-dashboardbookings .cmp-bookingexport {
    top: -1.5rem; } }

@media only screen and (min-width: 640px) {
  .pag-dashboardbookings .cmp-bookingexport {
    -ms-transform: translateY(-100%);
        transform: translateY(-100%); } }

.pag-dashboardbookings .cmp-upsellingbanner {
  margin-bottom: 1.5rem; }
  @media only screen and (min-width: 640px) {
    .pag-dashboardbookings .cmp-upsellingbanner {
      margin-bottom: 2.625rem; } }

.pag-dashboardbookings .tabs {
  border-bottom: none;
  display: inline-block;
  margin-bottom: 1.5rem; }

.pag-dashboardbookings-action {
  padding-right: 1.5rem; }

.pag-dashboardbookings-content {
  margin-bottom: 3rem;
  margin-top: 1.5rem;
  position: relative; }
  .pag-dashboardbookings-content.overlayed {
    opacity: 0.2;
    position: relative; }
  .pag-dashboardbookings-content.overlayed .pag-dashboardbookings-contentoverlay {
    bottom: 0;
    cursor: default;
    left: 0;
    position: absolute;
    right: 0;
    top: 0;
    z-index: 700; }

.pag-dashboardbookings-filterstages {
  margin-bottom: 2rem; }
  .pag-dashboardbookings-filterstages .row {
    margin-left: 0;
    margin-right: 0; }

.pag-dashboardbookings-filterstagescount {
  margin-right: 0.5rem; }
  @media only screen and (min-width: 640px) {
    .pag-dashboardbookings-filterstagescount {
      display: block; } }

.pag-dashboardbookings-headsup {
  padding: 0.5rem 0.875rem;
  position: relative; }
  @media only screen and (min-width: 960px) {
    .pag-dashboardbookings-headsup {
      padding: 1rem 1.5rem; } }

.pag-dashboardbookings-headsupbutton {
  margin-top: 0.25rem; }

.pag-dashboardbookings-headsupimage {
  height: 3.5rem;
  width: 3.5rem; }
  @media only screen and (min-width: 640px) {
    .pag-dashboardbookings-headsupimage {
      position: absolute; } }

.pag-dashboardbookings-headsupicon {
  font-size: 3.5rem; }
  @media only screen and (min-width: 640px) {
    .pag-dashboardbookings-headsupicon {
      position: absolute; } }
  @media only screen and (min-width: 640px) {
    .pag-dashboardbookings-headsupicon {
      top: 50%; } }
  @media only screen and (min-width: 640px) {
    .pag-dashboardbookings-headsupicon {
      -ms-transform: translateY(-50%);
          transform: translateY(-50%); } }

.pag-dashboardbookings-headsuptexts {
  margin: 0.25rem 0; }
  @media only screen and (min-width: 640px) {
    .pag-dashboardbookings-headsuptexts {
      margin: 0.25rem 0 0.25rem 4.5rem; } }

.pag-dashboardbookings-headsuptitle {
  margin-bottom: 0.25rem; }

.pag-dashboardorganizations .tabs {
  border-bottom: none;
  display: inline-block;
  margin-bottom: 1.5rem; }

.pag-dashboardorganizations-actions {
  margin: 1rem auto; }
  @media only screen and (min-width: 640px) {
    .pag-dashboardorganizations-actions {
      margin: 2rem auto; } }

.pag-dashboardorganizations-action {
  padding-bottom: 1rem;
  padding-right: 1rem; }

.pag-dashboardorganizations-content {
  min-width: 40rem; }
  .pag-dashboardorganizations-content.overlayed {
    opacity: 0.2;
    position: relative; }
  .pag-dashboardorganizations-content.overlayed .pag-dashboardorganizations-contentoverlay {
    bottom: 0;
    cursor: default;
    left: 0;
    position: absolute;
    right: 0;
    top: 0;
    z-index: 700; }

.pag-dashboardrfp-legend > .row {
  border-bottom: 1px solid #ccc; }

.pag-dashboardrfp-legendicon {
  margin-right: 0.4rem;
  position: relative;
  top: 0.05rem; }

.pag-dashboardrfp-legendlink {
  text-transform: uppercase; }

.pag-dashboardrfp-legendsort {
  cursor: pointer; }

.pag-dashboardrfp-legendtext {
  color: #aaa;
  text-transform: uppercase; }

.pag-dashboardrfp-table {
  margin-bottom: 3rem;
  margin-top: 1.5rem; }
  @media only screen and (min-width: 640px) {
    .pag-dashboardrfp-table {
      min-width: 40rem; } }
  .pag-dashboardrfp-table > .row {
    border-bottom: 1px solid #ccc;
    position: relative; }
    .pag-dashboardrfp-table > .row:last-child {
      border-bottom: none; }
    .pag-dashboardrfp-table > .row > .column, .pag-dashboardrfp-table > .row > .columns {
      padding-top: 0.5rem;
      padding-bottom: 0.5rem; }
      @media only screen and (min-width: 640px) {
        .pag-dashboardrfp-table > .row > .column, .pag-dashboardrfp-table > .row > .columns {
          padding-top: 1rem; } }
      @media only screen and (min-width: 640px) {
        .pag-dashboardrfp-table > .row > .column, .pag-dashboardrfp-table > .row > .columns {
          padding-bottom: 1rem; } }

.pag-dashboardrfp-title {
  margin-bottom: 0.5rem;
  margin-right: 1rem;
  text-transform: uppercase; }
  @media only screen and (min-width: 640px) {
    .pag-dashboardrfp-title {
      display: inline-block; } }

.pag-dashboardspaces-add {
  margin-top: 4rem;
  text-align: center; }
  .pag-dashboardspaces-add p {
    margin-bottom: 0.5rem; }

.pag-dashboardspaces-divider {
  margin-top: 1rem;
  color: #757575; }

.pag-dashboardspaces-promo {
  padding: 0.5rem 0.875rem;
  position: relative; }
  @media only screen and (min-width: 960px) {
    .pag-dashboardspaces-promo {
      padding: 1rem 1.5rem; } }

.pag-dashboardspaces-promobutton {
  margin-top: 0.25rem; }

.pag-dashboardspaces-promoimage {
  height: 3.5rem;
  width: 3.5rem; }
  @media only screen and (min-width: 640px) {
    .pag-dashboardspaces-promoimage {
      position: absolute; } }

.pag-dashboardspaces-promoicon {
  font-size: 3.5rem; }
  @media only screen and (min-width: 640px) {
    .pag-dashboardspaces-promoicon {
      position: absolute; } }
  @media only screen and (min-width: 640px) {
    .pag-dashboardspaces-promoicon {
      top: 50%; } }
  @media only screen and (min-width: 640px) {
    .pag-dashboardspaces-promoicon {
      -ms-transform: translateY(-50%);
          transform: translateY(-50%); } }

.pag-dashboardspaces-promotexts {
  margin: 0.25rem 0; }
  @media only screen and (min-width: 640px) {
    .pag-dashboardspaces-promotexts {
      margin: 0.25rem 0 0.25rem 4.5rem; } }

.pag-dashboardspaces-promotitle {
  margin-bottom: 0.25rem; }

.pag-dashboardspaces-promo {
  margin-bottom: 2rem; }
  @media only screen and (min-width: 640px) {
    .pag-dashboardspaces-promo {
      margin-bottom: 4rem; } }

.pag-dashboardspaces-venue {
  margin-top: 2rem; }

.pag-dashboardusers .tabs {
  border-bottom: none;
  display: inline-block;
  margin-bottom: 1.5rem; }

.pag-dashboardusers-content {
  position: relative;
  min-width: 40rem; }
  .pag-dashboardusers-content.overlayed {
    opacity: 0.2;
    position: relative; }
  .pag-dashboardusers-content.overlayed .pag-dashboardusers-contentoverlay {
    bottom: 0;
    cursor: default;
    left: 0;
    position: absolute;
    right: 0;
    top: 0;
    z-index: 700; }

.pag-dashboardusers-discountintro {
  margin-bottom: 1rem; }

.pag-errorpage-header {
  background-repeat: no-repeat;
  background-position: center;
  background-size: cover;
  width: 100%;
  padding-bottom: 24rem;
  position: relative; }
  @media only screen and (min-width: 640px) {
    .pag-errorpage-header {
      padding-bottom: 32rem; } }
  @media only screen and (min-width: 960px) {
    .pag-errorpage-header {
      padding-bottom: 40rem; } }
  @media only screen and (min-width: 1280px) {
    .pag-errorpage-header {
      padding-bottom: 48rem; } }
  @media only screen and (min-width: 1600px) {
    .pag-errorpage-header {
      padding-bottom: 56rem; } }

.pag-errorpage-tips {
  max-width: 40rem;
  position: absolute;
  left: 0;
  margin: 0 auto;
  right: 0;
  text-align: center;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%); }

.pag-errorpage-tipsbutton {
  margin: 1rem auto;
  min-width: 10rem; }

.pag-errorpage-tipscomment {
  color: #757575;
  margin-bottom: 0.5rem; }

.pag-errorpage-tipstext {
  margin-bottom: 1rem; }

.pag-errorpage-tipstitle {
  font-size: 2.5rem;
  margin-bottom: 0.5rem; }
  @media only screen and (min-width: 640px) {
    .pag-errorpage-tipstitle {
      font-size: 3.25rem; } }

.pag-eventmodels .pag-eventmodels-scrollable {
  scrollbar-width: thin;
  scrollbar-color: #e3e3e3 transparent;
  overflow-x: scroll;
  white-space: nowrap;
  margin: 0 -0.625rem 0.5rem; }
  .pag-eventmodels .pag-eventmodels-scrollable::-webkit-scrollbar {
    height: 6px; }
  .pag-eventmodels .pag-eventmodels-scrollable::-webkit-scrollbar-thumb {
    background-color: #e3e3e3;
    border-radius: 2px; }
  .pag-eventmodels .pag-eventmodels-scrollable > .cmp-tileeventmodel {
    display: inline-block;
    margin: 0 0.625rem 1rem;
    vertical-align: top;
    width: 18rem; }

.pag-eventmodels .cmp-footersection {
  margin-top: 10rem; }

.pag-eventmodels .cmp-seodescription h2 {
  margin-top: 0; }

.pag-hiredetail .lyt-sided {
  margin: 0.75rem auto 0;
  padding: 0 0.75rem; }
  @media only screen and (min-width: 960px) {
    .pag-hiredetail .lyt-sided {
      margin: 1.25rem auto 0; } }
  @media only screen and (min-width: 640px) {
    .pag-hiredetail .lyt-sided {
      max-width: 640px; } }
  @media only screen and (min-width: 960px) {
    .pag-hiredetail .lyt-sided {
      max-width: 920px; } }
  @media only screen and (min-width: 1280px) {
    .pag-hiredetail .lyt-sided {
      max-width: 1160px; } }
  @media only screen and (min-width: 1600px) {
    .pag-hiredetail .lyt-sided {
      max-width: 1160px; } }
  @media only screen and (min-width: 640px) {
    .pag-hiredetail .lyt-sided {
      padding: 0 20px; } }

@media only screen and (min-width: 960px) {
  .pag-hiredetail .lyt-sided {
    position: relative; } }

@media only screen and (min-width: 960px) {
  .pag-hiredetail .lyt-sided:after {
    content: ""; } }

@media only screen and (min-width: 960px) {
  .pag-hiredetail .lyt-sided:after {
    display: table; } }

@media only screen and (min-width: 960px) {
  .pag-hiredetail .lyt-sided:after {
    clear: both; } }

.pag-hiredetail .lyt-sided .lyt-sided-aside {
  width: 100%; }
  @media only screen and (min-width: 960px) {
    .pag-hiredetail .lyt-sided .lyt-sided-aside {
      float: right; } }
  @media only screen and (min-width: 960px) {
    .pag-hiredetail .lyt-sided .lyt-sided-aside {
      width: 320px; } }
  .pag-hiredetail .lyt-sided .lyt-sided-aside + .lyt-sided-main {
    margin-top: 2.5rem; }
    @media only screen and (min-width: 960px) {
      .pag-hiredetail .lyt-sided .lyt-sided-aside + .lyt-sided-main {
        margin-top: 0; } }

.pag-hiredetail .lyt-sided .lyt-sided-main {
  width: 100%; }
  @media only screen and (min-width: 960px) {
    .pag-hiredetail .lyt-sided .lyt-sided-main {
      float: left; } }
  @media only screen and (min-width: 960px) {
    .pag-hiredetail .lyt-sided .lyt-sided-main {
      width: 520px; } }
  @media only screen and (min-width: 1280px) {
    .pag-hiredetail .lyt-sided .lyt-sided-main {
      width: 760px; } }
  @media only screen and (min-width: 1600px) {
    .pag-hiredetail .lyt-sided .lyt-sided-main {
      width: 760px; } }
  .pag-hiredetail .lyt-sided .lyt-sided-main + .lyt-sided-aside {
    margin-top: 2.5rem; }
    @media only screen and (min-width: 960px) {
      .pag-hiredetail .lyt-sided .lyt-sided-main + .lyt-sided-aside {
        margin-top: 0; } }
    @media only screen and (min-width: 1280px) {
      .pag-hiredetail .lyt-sided .lyt-sided-main + .lyt-sided-aside .lyt-sided-aside-fixed {
        position: fixed; } }
    @media only screen and (min-width: 1280px) {
      .pag-hiredetail .lyt-sided .lyt-sided-main + .lyt-sided-aside .lyt-sided-aside-fixed {
        width: 320px; } }

.pag-hiredetail .cmp-assistantsection {
  padding: 2.5rem 0; }
  @media only screen and (min-width: 640px) {
    .pag-hiredetail .cmp-assistantsection {
      padding: 2.5rem 0.625rem; } }

.pag-hiredetail .cmp-bookingbrowser {
  margin-top: 6rem; }

.pag-hiredetail .cmp-conversation-actionmessage label {
  display: none; }

.pag-hiredetail .cmp-paymentmethods {
  margin-bottom: 1rem;
  margin-top: 1rem; }

.pag-hiredetail .cmp-reviewelement {
  margin-top: 1rem; }

.pag-hiredetail .cmp-reviewsteps {
  position: relative;
  top: -0.5rem; }

.pag-hiredetail-accordion {
  margin-left: -1rem; }
  @media only screen and (min-width: 640px) {
    .pag-hiredetail-accordion {
      margin-left: 0; } }

.pag-hiredetail-action .button {
  margin-bottom: 0.25rem;
  width: 100%; }

.pag-hiredetail-action .column, .pag-hiredetail-action .columns {
  padding-bottom: 0.25rem;
  padding-top: 0.25rem; }

.pag-hiredetail-attachments {
  margin: 1.25rem 0; }

.pag-hiredetail-cancellationbutton {
  height: auto;
  margin: 0.5rem 0 0 0;
  padding: 0.65rem 0.9rem !important; }

.pag-hiredetail-conversationunread {
  background-color: #e75635;
  border-radius: 50%;
  color: #fefefe;
  display: inline-block;
  font-weight: normal;
  font-size: 0.875rem;
  height: 1.2rem;
  padding: 0.2rem 0;
  position: absolute;
  text-align: center;
  top: 0.25rem;
  width: 1.2rem; }

.pag-hiredetail-helptext {
  font-size: 0.875rem; }

.pag-hiredetail-highlightedtext {
  margin-bottom: 0.75rem; }

.pag-hiredetail-highlightedtitle {
  margin-bottom: 0.5rem; }

.pag-hiredetail-highlightedwrapper {
  background-color: #eee;
  margin-bottom: 2rem;
  padding: 1rem 1.5rem; }
  .pag-hiredetail-highlightedwrapper.warning {
    background-color: rgba(255, 174, 0, 0.15); }

.pag-hiredetail-hirechangebuttons {
  margin-top: 0.75rem; }

.pag-hiredetail-hirechangeerrors {
  margin-top: 0.75rem; }

.pag-hiredetail-hirechangelist {
  margin: 0.5rem 0 1rem 1.5rem; }

.pag-hiredetail-hirechangeintrotext {
  margin-bottom: 0.5rem; }

.pag-hiredetail-hirechangenote {
  color: #aaa;
  font-size: 0.875rem;
  margin-top: 1rem; }

.pag-hiredetail-hiresetform + .pag-hiredetail-hiresetform {
  margin-top: 2.5rem; }

.pag-hiredetail-hiresetform .cmp-paypal {
  display: inline-block;
  top: 0.875rem; }

.pag-hiredetail-hiresetform .cmp-paypal-label {
  display: none; }

.pag-hiredetail-hiresethelp {
  margin-top: 1rem; }

.pag-hiredetail-hiresethelplist {
  margin: 0.25rem 0 0.25rem 1.5rem; }
  .pag-hiredetail-hiresethelplist li {
    font-size: 0.875rem; }

.pag-hiredetail-invitefield {
  margin-top: 0.75rem;
  margin-bottom: 0.5rem; }

.pag-hiredetail-inviteguests {
  margin-bottom: 0.5rem;
  margin-top: 0.75rem; }

.pag-hiredetail-next {
  margin-bottom: 2rem; }
  .pag-hiredetail-next input {
    margin-bottom: 0.25rem; }
  .pag-hiredetail-next .button {
    margin: 0.25rem 0.5rem 0.25rem 0;
    min-width: 9rem; }
  .pag-hiredetail-next .cmp-invoiceaddresses {
    margin-bottom: 0.5rem; }
  .pag-hiredetail-next .cmp-enquiryanswerservices-hiredurationtext {
    text-align: start; }

.pag-hiredetail-nextcomment {
  margin-bottom: 0.5rem; }

.pag-hiredetail-nextimage {
  display: none;
  position: absolute;
  text-align: center; }
  @media only screen and (min-width: 640px) {
    .pag-hiredetail-nextimage {
      display: block; } }
  @media only screen and (min-width: 640px) {
    .pag-hiredetail-nextimage + .pag-hiredetail-nexttexts {
      margin-left: 3.5rem; } }

.pag-hiredetail-nextimage {
  width: 9rem; }
  @media only screen and (min-width: 640px) {
    .pag-hiredetail-nextimage + .pag-hiredetail-nexttexts {
      margin-left: 11rem; } }

.pag-hiredetail-nextoffer {
  max-width: 32rem; }
  .pag-hiredetail-nextoffer.row {
    margin: 0.75rem -0.25rem; }
    .pag-hiredetail-nextoffer.row .column, .pag-hiredetail-nextoffer.row .columns {
      padding: 0.25rem; }
  .pag-hiredetail-nextoffer label {
    color: #333;
    display: block;
    font-size: 1rem;
    padding: 0.825rem 0; }

.pag-hiredetail-nextofferoptional {
  color: #aaa;
  font-size: 0.875rem; }

.pag-hiredetail-nextoffertitle {
  color: #e75635;
  font-weight: bold; }

.pag-hiredetail-nextpolicy {
  color: #757575;
  font-size: 0.875rem;
  margin-bottom: 0.15rem; }

.pag-hiredetail-nextstar {
  cursor: pointer;
  font-size: 2.5rem;
  margin-top: 0.5rem;
  opacity: 0.2; }
  .pag-hiredetail-nextstar:nth-child(1), .pag-hiredetail-nextstar:nth-child(2), .pag-hiredetail-nextstar:nth-child(3) {
    color: #cc4b37; }
  .pag-hiredetail-nextstar:nth-child(4) {
    color: #ffae00; }
  .pag-hiredetail-nextstar:nth-child(5) {
    color: #66c17b; }

.pag-hiredetail-nextterms {
  color: #757575;
  font-size: 0.875rem;
  margin-top: 0.5rem;
  text-align: left; }
  .pag-hiredetail-nextterms a {
    font-size: 0.875rem; }

.pag-hiredetail-nexttext {
  margin-bottom: 1rem; }

.pag-hiredetail-nexttitle {
  margin-bottom: 0.75rem; }

.pag-hiredetail-recapcomment {
  margin-top: 1rem; }

.pag-hiredetail-recapintro {
  margin-bottom: 1rem; }

.pag-hiredetail-recaplink {
  display: block;
  margin-top: 1rem; }

.pag-hiredetail-recapsemitransparent {
  opacity: 0.5; }

.pag-hiredetail-recaptitle {
  margin-bottom: 1rem; }

.pag-hiredetail-review {
  margin-top: 1rem; }
  .pag-hiredetail-review .button {
    margin: 0.25rem; }

.pag-hiredetail-similar {
  scrollbar-width: thin;
  scrollbar-color: #e3e3e3 transparent;
  overflow-x: scroll;
  white-space: nowrap;
  margin: 1rem -0.625rem; }
  .pag-hiredetail-similar::-webkit-scrollbar {
    height: 6px; }
  .pag-hiredetail-similar::-webkit-scrollbar-thumb {
    background-color: #e3e3e3;
    border-radius: 2px; }
  .pag-hiredetail-similar .cmp-tilelist {
    display: inline-block;
    margin: 0 0.625rem 1rem;
    vertical-align: top;
    width: 18rem; }

.pag-hiredetail-subsection {
  margin-bottom: 1rem; }

.pag-hiredetail-status {
  margin-bottom: 2rem; }

.pag-hireform .lyt-sided {
  margin: 0.75rem auto 0;
  padding: 0 0.75rem; }
  @media only screen and (min-width: 960px) {
    .pag-hireform .lyt-sided {
      margin: 1.25rem auto 0; } }
  @media only screen and (min-width: 640px) {
    .pag-hireform .lyt-sided {
      max-width: 640px; } }
  @media only screen and (min-width: 960px) {
    .pag-hireform .lyt-sided {
      max-width: 920px; } }
  @media only screen and (min-width: 1280px) {
    .pag-hireform .lyt-sided {
      max-width: 1160px; } }
  @media only screen and (min-width: 1600px) {
    .pag-hireform .lyt-sided {
      max-width: 1160px; } }
  @media only screen and (min-width: 640px) {
    .pag-hireform .lyt-sided {
      padding: 0 20px; } }

@media only screen and (min-width: 960px) {
  .pag-hireform .lyt-sided {
    position: relative; } }

@media only screen and (min-width: 960px) {
  .pag-hireform .lyt-sided:after {
    content: ""; } }

@media only screen and (min-width: 960px) {
  .pag-hireform .lyt-sided:after {
    display: table; } }

@media only screen and (min-width: 960px) {
  .pag-hireform .lyt-sided:after {
    clear: both; } }

.pag-hireform .lyt-sided .lyt-sided-aside {
  width: 100%; }
  @media only screen and (min-width: 960px) {
    .pag-hireform .lyt-sided .lyt-sided-aside {
      float: right; } }
  @media only screen and (min-width: 960px) {
    .pag-hireform .lyt-sided .lyt-sided-aside {
      width: 320px; } }
  .pag-hireform .lyt-sided .lyt-sided-aside + .lyt-sided-main {
    margin-top: 2.5rem; }
    @media only screen and (min-width: 960px) {
      .pag-hireform .lyt-sided .lyt-sided-aside + .lyt-sided-main {
        margin-top: 0; } }

.pag-hireform .lyt-sided .lyt-sided-main {
  width: 100%; }
  @media only screen and (min-width: 960px) {
    .pag-hireform .lyt-sided .lyt-sided-main {
      float: left; } }
  @media only screen and (min-width: 960px) {
    .pag-hireform .lyt-sided .lyt-sided-main {
      width: 520px; } }
  @media only screen and (min-width: 1280px) {
    .pag-hireform .lyt-sided .lyt-sided-main {
      width: 760px; } }
  @media only screen and (min-width: 1600px) {
    .pag-hireform .lyt-sided .lyt-sided-main {
      width: 760px; } }
  .pag-hireform .lyt-sided .lyt-sided-main + .lyt-sided-aside {
    margin-top: 2.5rem; }
    @media only screen and (min-width: 960px) {
      .pag-hireform .lyt-sided .lyt-sided-main + .lyt-sided-aside {
        margin-top: 0; } }
    @media only screen and (min-width: 1280px) {
      .pag-hireform .lyt-sided .lyt-sided-main + .lyt-sided-aside .lyt-sided-aside-fixed {
        position: fixed; } }
    @media only screen and (min-width: 1280px) {
      .pag-hireform .lyt-sided .lyt-sided-main + .lyt-sided-aside .lyt-sided-aside-fixed {
        width: 320px; } }

.pag-hireform .cmp-bars {
  margin: 1rem auto 0; }
  @media only screen and (min-width: 960px) {
    .pag-hireform .cmp-bars {
      max-width: 880px; } }
  @media only screen and (min-width: 1280px) {
    .pag-hireform .cmp-bars {
      max-width: 1120px; } }

.pag-hireform .cmp-tilebooking {
  margin-bottom: 2.5rem; }

.pag-hireform .cmp-certificateimage {
  margin-top: 0;
  max-width: 10rem;
  vertical-align: baseline; }

.pag-hireform .cmp-paymentmethods {
  margin-bottom: 0.5rem; }

.pag-hireform .cmp-priceperson {
  display: none; }

.pag-hireform .cmp-pricingbreakdown {
  margin-top: 1rem; }

.pag-hireform .cmp-reviewelement {
  text-align: left; }

.pag-hireform .cmp-reviewelement-ratingagain {
  color: #757575; }

.pag-hireform .cmp-reviewelement-ratingstar {
  color: #757575; }

.pag-hireform input[name=repeats] + .errorlist {
  display: none; }

.pag-hireform-adddetailsbtn {
  margin-left: 2rem; }

.pag-hireform-attract {
  margin: 4rem auto;
  padding: 0 0.625rem; }
  @media only screen and (min-width: 640px) {
    .pag-hireform-attract {
      padding: 0; } }

.pag-hireform-attractassistant {
  margin: 0 auto; }

.pag-hireform-attractelement {
  display: inline-block;
  margin: 0 2rem;
  max-width: 20rem;
  vertical-align: top; }

.pag-hireform-attracttitle {
  margin-bottom: 1rem;
  text-align: center; }

.pag-hireform-availability {
  color: #757575;
  font-size: 0.875rem;
  margin: 0.25rem 0 0.5rem; }
  .pag-hireform-availability:empty {
    margin: 0; }

.pag-hireform-cancellation {
  margin-bottom: 0.75rem;
  padding-top: 0.25rem; }

.pag-hireform-comment {
  margin-bottom: 0.5rem; }

.pag-hireform-extrasadditional {
  border: 2px solid #ccc;
  border-radius: 2px;
  color: #757575;
  display: inline-block;
  font-weight: normal;
  margin: 0 0.45rem 0.45rem 0;
  padding: 0.225rem 0.875rem 0.225rem 0.45rem !important; }
  .pag-hireform-extrasadditional i {
    color: #757575;
    font-size: 0.875rem; }

.pag-hireform-extrascategory {
  color: #757575;
  font-size: 0.875rem;
  margin: 0.25rem 0; }

.pag-hireform-extrashotel {
  padding: 0.75rem 1rem; }
  .pag-hireform-extrashotel input:checked + label {
    color: #e75635; }
  .pag-hireform-extrashotel input:checked ~ .pag-extras-hotel-wrapper {
    display: block; }
  .pag-hireform-extrashotel input[type=date] {
    padding-left: 0.5rem !important;
    padding-right: 0.5rem !important; }

.pag-hireform-extrashotelcomment {
  font-size: 0.875rem; }

.pag-hireform-extrashotelwrapper {
  display: none;
  padding-left: 25px; }

.pag-hireform-legaltext {
  color: #757575;
  font-size: 0.875rem;
  margin-top: 0.5rem;
  text-align: left; }
  .pag-hireform-legaltext a {
    font-size: 0.875rem; }

.pag-hireform-paymentuspcomment {
  margin-top: 0.75rem;
  text-align: left; }

.pag-hireform-paymentuspgrid.grid-margin-y {
  margin-bottom: -0.375rem;
  margin-top: -0.375rem; }
  .pag-hireform-paymentuspgrid.grid-margin-y > .cell {
    margin-bottom: 0.375rem;
    margin-top: 0.375rem; }

.pag-hireform-recapbreakdown {
  padding: 0.65rem; }
  .pag-hireform-recapbreakdown h3 {
    margin-bottom: 0.305rem; }
  .pag-hireform-recapbreakdown p {
    margin-bottom: 0.13rem; }

.pag-hireform-recapsequences {
  font-size: 0.875rem;
  text-align: justify;
  color: #757575;
  margin-bottom: 1rem;
  margin-top: 0.25rem; }

.pag-hireform-reviewskpi {
  padding: 0.5rem 0.5rem 0.5rem 0.75rem;
  position: relative; }
  @media only screen and (min-width: 640px) {
    .pag-hireform-reviewskpi {
      padding: 0.75rem 0.75rem 0.75rem 1.25rem; } }

.pag-hireform-reviewskpicircle {
  border: 4px solid transparent;
  border-left-color: #e3e3e3;
  border-radius: 50%;
  border-right-color: #e3e3e3;
  border-top-color: #e3e3e3;
  position: absolute;
  height: 100%;
  right: 0;
  top: 0;
  width: 100%; }
  .pag-hireform-reviewskpicircle.rotate-1 {
    -ms-transform: rotate(22.5deg);
        transform: rotate(22.5deg); }
  .pag-hireform-reviewskpicircle.rotate-2 {
    -ms-transform: rotate(-157.5deg);
        transform: rotate(-157.5deg); }
  .pag-hireform-reviewskpicircle.rotate-3 {
    -ms-transform: rotate(112.5deg);
        transform: rotate(112.5deg); }
  .pag-hireform-reviewskpicircle.rotate-4 {
    -ms-transform: rotate(-67.5deg);
        transform: rotate(-67.5deg); }

.pag-hireform-reviewskpiicon {
  color: #aaa;
  height: 2.2rem;
  position: absolute;
  right: 0.5rem;
  text-align: center;
  top: 0.5rem;
  width: 2.2rem; }
  @media only screen and (min-width: 640px) {
    .pag-hireform-reviewskpiicon {
      right: 0.75rem; } }
  @media only screen and (min-width: 640px) {
    .pag-hireform-reviewskpiicon {
      top: 0.75rem; } }
  .pag-hireform-reviewskpiicon i {
    margin: 0.6rem 0; }

.pag-hireform-reviewskpitext {
  margin-right: 2.75rem; }

.pag-hireform-reviewskpititle {
  font-size: 0.875rem;
  margin-bottom: 0.15rem; }

.pag-hireform-reviewskpivalue {
  font-weight: bold; }

.pag-hireform-reviewskpi {
  margin-bottom: 1rem;
  text-align: left; }

.pag-hireform-title {
  margin-bottom: 2.5rem; }

.pag-hireform-waypointref {
  margin-top: 1rem; }

.pag-hireform-wrapper {
  padding: 0 0.625rem; }
  @media only screen and (min-width: 640px) {
    .pag-hireform-wrapper {
      padding: 0; } }

.pag-homepage .cmp-flatpageteam + .cmp-upsellingbanner {
  margin-top: 5rem; }
  @media only screen and (min-width: 960px) {
    .pag-homepage .cmp-flatpageteam + .cmp-upsellingbanner {
      margin-top: 10rem; } }

.pag-homepage .cmp-footernewsletter {
  padding: 0;
  text-align: left; }

.pag-homepage .cmp-footernewsletter-button {
  background-color: transparent; }
  .pag-homepage .cmp-footernewsletter-button, .pag-homepage .cmp-footernewsletter-button.disabled, .pag-homepage .cmp-footernewsletter-button[disabled], .pag-homepage .cmp-footernewsletter-button.disabled:hover, .pag-homepage .cmp-footernewsletter-button[disabled]:hover, .pag-homepage .cmp-footernewsletter-button.disabled:focus, .pag-homepage .cmp-footernewsletter-button[disabled]:focus {
    border: 1px solid black;
    color: black; }
  .pag-homepage .cmp-footernewsletter-button:hover, .pag-homepage .cmp-footernewsletter-button:focus {
    border-color: black;
    color: black; }
  @media only screen and (min-width: 640px) {
    .pag-homepage .cmp-footernewsletter-button {
      width: 25%; } }

.pag-homepage .cmp-footernewsletter-checkbox {
  margin-top: 1rem; }

.pag-homepage .cmp-footernewsletter-email input {
  max-width: none;
  width: 100%; }
  @media only screen and (min-width: 640px) {
    .pag-homepage .cmp-footernewsletter-email input {
      margin-right: 4%; } }
  @media only screen and (min-width: 640px) {
    .pag-homepage .cmp-footernewsletter-email input {
      width: 70%; } }

.pag-homepage .cmp-footernewsletter-title {
  color: #333;
  font-weight: normal;
  margin-bottom: 0.5rem;
  text-transform: none; }

.pag-homepage .cmp-navigation:not(.sticky) {
  z-index: 200; }
  @media only screen and (min-width: 960px) {
    .pag-homepage .cmp-navigation:not(.sticky) {
      background-color: transparent; } }
  @media only screen and (min-width: 960px) {
    .pag-homepage .cmp-navigation:not(.sticky) .top-bar {
      background-color: transparent; } }
  @media only screen and (min-width: 960px) {
    .pag-homepage .cmp-navigation:not(.sticky) .top-bar {
      box-shadow: none; } }
  @media only screen and (min-width: 1280px) {
    .pag-homepage .cmp-navigation:not(.sticky) .top-bar {
      margin: 0 auto; } }
  @media only screen and (min-width: 1280px) {
    .pag-homepage .cmp-navigation:not(.sticky) .top-bar {
      max-width: 90rem; } }

.pag-homepage .cmp-navigation .sb-sticky-navigation-action .pag-homepage-formcard {
  box-shadow: none;
  padding: 0; }

.pag-homepage .cmp-navigation .sb-sticky-navigation-action .column, .pag-homepage .cmp-navigation .sb-sticky-navigation-action .columns {
  float: none;
  padding: 0;
  width: 100%; }

.pag-homepage .cmp-navigation .sb-sticky-navigation-hidden {
  display: none; }

.pag-homepage-actiongrid {
  max-width: 32rem;
  margin-left: auto;
  margin-right: auto; }

.pag-homepage-actionimages {
  left: 2rem;
  margin-top: 0.75rem;
  position: relative; }
  @media only screen and (min-width: 640px) {
    .pag-homepage-actionimages {
      left: 4rem; } }

.pag-homepage-actionlogo {
  margin-top: 0.5rem;
  max-height: 3.25rem; }

.pag-homepage-actiontext {
  margin-top: 1.5rem; }

.pag-homepage-background {
  background-color: #f7f7f7; }

.pag-homepage-bookingheadlinetext {
  margin-bottom: 1rem; }
  @media only screen and (min-width: 640px) {
    .pag-homepage-bookingheadlinetext {
      margin-bottom: 2rem; } }

.pag-homepage-chipcontainer {
  display: -ms-flexbox;
  display: flex;
  -ms-flex-wrap: wrap;
      flex-wrap: wrap;
  row-gap: 0.5rem;
  column-gap: 0.2rem; }
  .pag-homepage-chipcontainer.margintop {
    margin-top: 0.5rem; }

.pag-homepage-featuredspacetypeicon {
  height: 1.25rem;
  object-fit: cover;
  padding-right: 0.1rem;
  position: relative;
  top: -0.1rem; }

.pag-homepage-featuredspacetypewrapper {
  padding-top: 2.5rem; }
  @media only screen and (min-width: 960px) {
    .pag-homepage-featuredspacetypewrapper {
      padding-top: 5rem; } }

.pag-homepage-form .cmp-inputiconed-icon {
  display: block; }
  @media only screen and (min-width: 640px) {
    .pag-homepage-form .cmp-inputiconed-icon {
      display: none; } }
  @media only screen and (min-width: 1280px) {
    .pag-homepage-form .cmp-inputiconed-icon {
      display: block; } }

.pag-homepage-formbutton {
  padding: 0.975rem 1rem 0.95rem; }

.pag-homepage-formcard {
  padding: 0 1rem; }
  @media only screen and (min-width: 960px) {
    .pag-homepage-formcard {
      padding: 0.75rem 1.25rem; } }

.pag-homepage-formlisttoggler {
  margin-top: 1rem; }

.pag-homepage-formlink {
  display: inline-block;
  padding: 0.25rem 0.5rem; }

.pag-homepage-formlinks {
  color: #aaa;
  margin-top: 0.25rem; }

.pag-homepage-header {
  height: auto;
  position: relative; }
  @media only screen and (min-width: 640px) {
    .pag-homepage-header {
      height: 28rem; } }
  @media only screen and (min-width: 1280px) {
    .pag-homepage-header {
      height: 32rem; } }
  @media only screen and (min-width: 1600px) {
    .pag-homepage-header {
      height: 36rem; } }

.pag-homepage-header {
  position: relative; }

.pag-homepage-headerimage {
  height: 100%;
  object-fit: cover;
  position: absolute;
  width: 100%; }

.pag-homepage-headercontent {
  margin: 0.75rem; }
  @media only screen and (min-width: 640px) {
    .pag-homepage-headercontent {
      margin: 0 5%; } }
  @media only screen and (min-width: 1280px) {
    .pag-homepage-headercontent {
      margin: 0 15%; } }
  @media only screen and (min-width: 640px) {
    .pag-homepage-headercontent {
      width: 45%; } }
  @media only screen and (min-width: 1280px) {
    .pag-homepage-headercontent {
      width: 32.5%; } }
  @media only screen and (min-width: 640px) {
    .pag-homepage-headercontent {
      position: absolute; } }
  @media only screen and (min-width: 640px) {
    .pag-homepage-headercontent {
      top: 50%; } }
  @media only screen and (min-width: 640px) {
    .pag-homepage-headercontent {
      -ms-transform: translateY(-50%);
          transform: translateY(-50%); } }

.pag-homepage-headerimage {
  -webkit-clip-path: polygon(0 0%, 0% 90%, 100% 100%, 100% 10%);
          clip-path: polygon(0 0%, 0% 90%, 100% 100%, 100% 10%);
  height: 15rem;
  position: relative;
  top: 1rem; }
  @media only screen and (min-width: 640px) {
    .pag-homepage-headerimage {
      -webkit-clip-path: polygon(10% 0, 0 100%, 100% 100%, 100% 0);
              clip-path: polygon(10% 0, 0 100%, 100% 100%, 100% 0); } }
  @media only screen and (min-width: 640px) {
    .pag-homepage-headerimage {
      height: 100%; } }
  @media only screen and (min-width: 640px) {
    .pag-homepage-headerimage {
      margin-left: 50%; } }
  @media only screen and (min-width: 640px) {
    .pag-homepage-headerimage {
      position: absolute; } }
  @media only screen and (min-width: 640px) {
    .pag-homepage-headerimage {
      top: 0; } }
  @media only screen and (min-width: 640px) {
    .pag-homepage-headerimage {
      width: 50%; } }

.pag-homepage-headerlogo {
  max-width: 10rem; }

.pag-homepage-headersection {
  margin-top: 2rem; }

.pag-homepage-headertitle {
  margin: 0.75rem auto; }

.pag-homepage-how {
  position: relative; }

.pag-homepage-howaction {
  margin-top: 0.25rem; }
  @media only screen and (min-width: 640px) {
    .pag-homepage-howaction {
      margin-top: 0.5rem; } }

@media only screen and (min-width: 960px) {
  .pag-homepage-howcontent {
    margin-right: 30rem; } }

.pag-homepage-howimage {
  display: none;
  position: absolute;
  right: 0;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%);
  width: 27rem; }
  @media only screen and (min-width: 960px) {
    .pag-homepage-howimage {
      display: block; } }

.pag-homepage-howtext {
  margin-bottom: 0.25rem; }

.pag-homepage-howtitle {
  margin-bottom: 0.25rem; }

.pag-homepage-intro {
  margin: 0 auto 1.25rem; }
  @media only screen and (min-width: 960px) {
    .pag-homepage-intro {
      margin: 0 auto 2.5rem; } }

.pag-homepage-introbutton {
  margin-top: 0.375rem; }
  @media only screen and (min-width: 960px) {
    .pag-homepage-introbutton {
      margin-top: 0.75rem; } }

.pag-homepage-introtitle {
  margin-bottom: 0.25rem; }
  @media only screen and (min-width: 960px) {
    .pag-homepage-introtitle {
      margin-bottom: 0.5rem; } }

.pag-homepage-merge {
  position: relative; }

.pag-homepage-mergecontent {
  margin-left: 0;
  margin-top: 0.75rem; }
  @media only screen and (min-width: 640px) {
    .pag-homepage-mergecontent {
      margin-left: 18.5rem; } }
  @media only screen and (min-width: 960px) {
    .pag-homepage-mergecontent {
      margin-left: 25rem; } }
  @media only screen and (min-width: 640px) {
    .pag-homepage-mergecontent {
      margin-top: 0; } }

.pag-homepage-mergelogo {
  max-width: 10rem; }
  @media only screen and (min-width: 640px) {
    .pag-homepage-mergelogo {
      left: 2rem; } }
  @media only screen and (min-width: 960px) {
    .pag-homepage-mergelogo {
      left: 7rem; } }
  @media only screen and (min-width: 640px) {
    .pag-homepage-mergelogo {
      position: absolute; } }
  @media only screen and (min-width: 640px) {
    .pag-homepage-mergelogo {
      top: 50%; } }
  @media only screen and (min-width: 640px) {
    .pag-homepage-mergelogo {
      -ms-transform: translateY(-50%);
          transform: translateY(-50%); } }

.pag-homepage-scrollable {
  scrollbar-width: thin;
  scrollbar-color: #e3e3e3 transparent;
  overflow-x: scroll;
  white-space: nowrap;
  margin: 0 -0.625rem 0.5rem; }
  .pag-homepage-scrollable::-webkit-scrollbar {
    height: 6px; }
  .pag-homepage-scrollable::-webkit-scrollbar-thumb {
    background-color: #e3e3e3;
    border-radius: 2px; }
  .pag-homepage-scrollable.spacedtop {
    margin-top: 1rem; }
  .pag-homepage-scrollable > .cmp-tileeventmodel, .pag-homepage-scrollable > .cmp-tilelist {
    display: inline-block;
    margin: 0 0.625rem 1rem;
    vertical-align: top;
    width: 18rem; }

.pag-homepage-signupbanner {
  display: -ms-flexbox;
  display: flex;
  -ms-flex-direction: column;
      flex-direction: column;
  -ms-flex-align: start;
      align-items: flex-start;
  gap: 1rem;
  padding: 1rem;
  background-color: #f1f8fd; }
  @media only screen and (min-width: 640px) {
    .pag-homepage-signupbanner {
      -ms-flex-direction: column;
          flex-direction: column; } }
  @media only screen and (min-width: 960px) {
    .pag-homepage-signupbanner {
      -ms-flex-direction: row;
          flex-direction: row; } }
  @media only screen and (min-width: 640px) {
    .pag-homepage-signupbanner {
      -ms-flex-align: start;
          align-items: flex-start; } }
  @media only screen and (min-width: 960px) {
    .pag-homepage-signupbanner {
      -ms-flex-align: end;
          align-items: flex-end; } }
  @media only screen and (min-width: 640px) {
    .pag-homepage-signupbanner {
      gap: 1.5rem; } }
  @media only screen and (min-width: 960px) {
    .pag-homepage-signupbanner {
      gap: 2.5rem; } }
  @media only screen and (min-width: 640px) {
    .pag-homepage-signupbanner {
      padding: 1.5rem; } }
  @media only screen and (min-width: 960px) {
    .pag-homepage-signupbanner {
      padding: 2.5rem; } }

@media only screen and (min-width: 960px) {
  .pag-homepage-signuptext {
    max-width: 20rem; } }

.pag-homepage-signupbannerimg {
  max-width: 12rem;
  max-height: 12rem; }

.pag-homepage-tagprovider {
  background-color: #f1f8fd;
  border-radius: 2px;
  color: #50aaeb;
  display: inline-block;
  font-size: 0.875rem;
  padding: 0.15rem 0.5rem;
  margin: 0.1rem; }

.pag-homepage-tagprovider:hover {
  color: rgba(80, 170, 235, 0.6); }

.pag-homepage-tagrenter {
  background-color: #fbe4df;
  border-radius: 2px;
  color: #e75635;
  display: inline-block;
  font-size: 0.875rem;
  padding: 0.15rem 0.5rem;
  margin: 0.1rem; }

.pag-homepage-title {
  padding-bottom: 1.75rem;
  padding-top: 1.75rem; }
  @media only screen and (min-width: 960px) {
    .pag-homepage-title {
      padding-bottom: 3.5rem; } }
  @media only screen and (min-width: 960px) {
    .pag-homepage-title {
      padding-top: 3.5rem; } }
  .pag-homepage-title span {
    color: #757575; }

.pag-homepage-wrapper {
  padding-bottom: 2.5rem;
  padding-top: 2.5rem; }
  @media only screen and (min-width: 960px) {
    .pag-homepage-wrapper {
      padding-bottom: 5rem; } }
  @media only screen and (min-width: 960px) {
    .pag-homepage-wrapper {
      padding-top: 5rem; } }

.pag-homepageorgstandard-help {
  position: relative; }

.pag-homepageorgstandard-helpicon {
  background-color: #e75635;
  border-radius: 50%;
  color: white;
  display: inline-block;
  height: 1.75rem;
  padding-top: 0.2rem;
  text-align: center;
  width: 1.75rem; }

.pag-homepageorgstandard-helpline {
  border-bottom: 1px solid #e75635;
  display: inline-block;
  margin-left: 1rem;
  position: absolute;
  top: 1.25rem;
  width: calc(100% - 4rem); }

.pag-homepageorgstandard-helptext {
  margin-top: 1rem; }

.pag-homepageorgstandard-welcome {
  padding: 0.5rem 0.875rem;
  position: relative; }
  @media only screen and (min-width: 960px) {
    .pag-homepageorgstandard-welcome {
      padding: 1rem 1.5rem; } }

.pag-homepageorgstandard-welcomebutton {
  margin-top: 0.25rem; }

.pag-homepageorgstandard-welcomeimage {
  height: 8rem;
  width: 8rem; }
  @media only screen and (min-width: 640px) {
    .pag-homepageorgstandard-welcomeimage {
      position: absolute; } }

.pag-homepageorgstandard-welcomeicon {
  font-size: 8rem; }
  @media only screen and (min-width: 640px) {
    .pag-homepageorgstandard-welcomeicon {
      position: absolute; } }
  @media only screen and (min-width: 640px) {
    .pag-homepageorgstandard-welcomeicon {
      top: 50%; } }
  @media only screen and (min-width: 640px) {
    .pag-homepageorgstandard-welcomeicon {
      -ms-transform: translateY(-50%);
          transform: translateY(-50%); } }

.pag-homepageorgstandard-welcometexts {
  margin: 0.25rem 0; }
  @media only screen and (min-width: 640px) {
    .pag-homepageorgstandard-welcometexts {
      margin: 0.25rem 0 0.25rem 9rem; } }

.pag-homepageorgstandard-welcometitle {
  margin-bottom: 0.25rem; }

.pag-homepageorgstandard-welcome {
  margin-bottom: 2.5rem; }

.pag-homepageorgstandard-welcomeimage {
  height: auto;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%); }

.pag-infoabout-header {
  height: auto;
  position: relative; }
  @media only screen and (min-width: 640px) {
    .pag-infoabout-header {
      height: 28rem; } }
  @media only screen and (min-width: 1280px) {
    .pag-infoabout-header {
      height: 32rem; } }
  @media only screen and (min-width: 1600px) {
    .pag-infoabout-header {
      height: 36rem; } }

.pag-infoabout-header {
  position: relative; }

.pag-infoabout-headerimage {
  height: 100%;
  object-fit: cover;
  position: absolute;
  width: 100%; }

.pag-infoabout-headercontent {
  margin: 0.75rem; }
  @media only screen and (min-width: 640px) {
    .pag-infoabout-headercontent {
      margin: 0 5%; } }
  @media only screen and (min-width: 1280px) {
    .pag-infoabout-headercontent {
      margin: 0 15%; } }
  @media only screen and (min-width: 640px) {
    .pag-infoabout-headercontent {
      width: 45%; } }
  @media only screen and (min-width: 1280px) {
    .pag-infoabout-headercontent {
      width: 32.5%; } }
  @media only screen and (min-width: 640px) {
    .pag-infoabout-headercontent {
      position: absolute; } }
  @media only screen and (min-width: 640px) {
    .pag-infoabout-headercontent {
      top: 50%; } }
  @media only screen and (min-width: 640px) {
    .pag-infoabout-headercontent {
      -ms-transform: translateY(-50%);
          transform: translateY(-50%); } }

.pag-infoabout-headerimage {
  -webkit-clip-path: polygon(0 0%, 0% 90%, 100% 100%, 100% 10%);
          clip-path: polygon(0 0%, 0% 90%, 100% 100%, 100% 10%);
  height: 15rem;
  position: relative;
  top: 1rem; }
  @media only screen and (min-width: 640px) {
    .pag-infoabout-headerimage {
      -webkit-clip-path: polygon(10% 0, 0 100%, 100% 100%, 100% 0);
              clip-path: polygon(10% 0, 0 100%, 100% 100%, 100% 0); } }
  @media only screen and (min-width: 640px) {
    .pag-infoabout-headerimage {
      height: 100%; } }
  @media only screen and (min-width: 640px) {
    .pag-infoabout-headerimage {
      margin-left: 50%; } }
  @media only screen and (min-width: 640px) {
    .pag-infoabout-headerimage {
      position: absolute; } }
  @media only screen and (min-width: 640px) {
    .pag-infoabout-headerimage {
      top: 0; } }
  @media only screen and (min-width: 640px) {
    .pag-infoabout-headerimage {
      width: 50%; } }

.pag-infoabout {
  background-color: #f7f7f7; }
  .pag-infoabout .header {
    color: #e75635;
    font-weight: bold; }

.pag-infoabout-applicationitemwrapper {
  padding: 0;
  gap: 1.5rem;
  margin-top: 3rem;
  display: -ms-flexbox;
  display: flex;
  -ms-flex-align: center;
      align-items: center;
  -ms-flex-direction: column;
      flex-direction: column; }
  @media only screen and (min-width: 960px) {
    .pag-infoabout-applicationitemwrapper {
      padding: 0 10rem 0 10rem; } }
  @media only screen and (min-width: 960px) {
    .pag-infoabout-applicationitemwrapper {
      gap: 2.5rem; } }
  @media only screen and (min-width: 640px) {
    .pag-infoabout-applicationitemwrapper {
      -ms-flex-direction: row;
          flex-direction: row; } }
  @media only screen and (min-width: 960px) {
    .pag-infoabout-applicationitemwrapper {
      -ms-flex-direction: row;
          flex-direction: row; } }
  .pag-infoabout-applicationitemwrapper img {
    width: 10rem;
    height: 10rem;
    object-fit: contain; }
  .pag-infoabout-applicationitemwrapper.reverse {
    -ms-flex-direction: column;
        flex-direction: column; }
    @media only screen and (min-width: 640px) {
      .pag-infoabout-applicationitemwrapper.reverse {
        -ms-flex-direction: row;
            flex-direction: row; } }
    @media only screen and (min-width: 960px) {
      .pag-infoabout-applicationitemwrapper.reverse {
        -ms-flex-direction: row-reverse;
            flex-direction: row-reverse; } }
  .pag-infoabout-applicationitemwrapper .pag-infoabout-applicationtexts {
    display: -ms-flexbox;
    display: flex;
    gap: 1rem;
    -ms-flex-pack: center;
        justify-content: center;
    -ms-flex-direction: column;
        flex-direction: column;
    -ms-flex-align: inherit;
        align-items: inherit;
    text-align: inherit; }
    @media only screen and (min-width: 640px) {
      .pag-infoabout-applicationitemwrapper .pag-infoabout-applicationtexts {
        -ms-flex-align: start;
            align-items: start; } }
    @media only screen and (min-width: 960px) {
      .pag-infoabout-applicationitemwrapper .pag-infoabout-applicationtexts {
        -ms-flex-align: start;
            align-items: start; } }
    @media only screen and (min-width: 640px) {
      .pag-infoabout-applicationitemwrapper .pag-infoabout-applicationtexts {
        text-align: start; } }
    @media only screen and (min-width: 960px) {
      .pag-infoabout-applicationitemwrapper .pag-infoabout-applicationtexts {
        text-align: start; } }
    .pag-infoabout-applicationitemwrapper .pag-infoabout-applicationtexts .pag-infoabout-applicationheader {
      font-weight: bold;
      color: #e75635; }
    .pag-infoabout-applicationitemwrapper .pag-infoabout-applicationtexts .pag-infoabout-applicationnumberwrapper {
      display: -ms-flexbox;
      display: flex;
      width: 1.5rem;
      height: 1.5rem;
      padding: 0.5rem;
      border-radius: 50%;
      background-color: #e75635;
      -ms-flex-pack: center;
          justify-content: center;
      -ms-flex-align: center;
          align-items: center; }
      .pag-infoabout-applicationitemwrapper .pag-infoabout-applicationtexts .pag-infoabout-applicationnumberwrapper span {
        color: #fefefe;
        font-weight: bold;
        font-size: 0.875rem; }

.pag-infoabout-awardimage {
  max-height: 10rem;
  max-width: 10rem;
  object-fit: contain; }

.pag-infoabout-benefitscontainer {
  margin-top: 1rem;
  margin-bottom: 1rem; }

.pag-infoabout-benefitswrapper {
  padding: 1rem;
  -ms-flex-pack: center;
      justify-content: center;
  height: 100%;
  row-gap: 1.5rem; }
  .pag-infoabout-benefitswrapper img {
    -ms-flex-item-align: start;
        align-self: start;
    max-height: 8rem;
    max-width: 12rem;
    object-fit: contain; }
  .pag-infoabout-benefitswrapper .pag-infoabout-benefitstextwrapper {
    gap: 1rem; }
  .pag-infoabout-benefitswrapper .pag-infoabout-benefitheader {
    font-weight: bold; }

.pag-infoabout-carousel {
  margin-bottom: 3rem; }
  .pag-infoabout-carousel .slick-dots {
    margin-left: -20px; }
  .pag-infoabout-carousel .pag-infoabout-carouselwrapper {
    margin-bottom: 1rem;
    gap: 2rem;
    -ms-flex-align: center;
        align-items: center;
    text-align: center; }
    .pag-infoabout-carousel .pag-infoabout-carouselwrapper img {
      border-radius: 50%;
      height: 8rem;
      width: 8rem;
      object-fit: cover; }
    .pag-infoabout-carousel .pag-infoabout-carouselwrapper .pag-infoabout-carouselrole {
      font-size: 0.875rem; }
    .pag-infoabout-carousel .pag-infoabout-carouselwrapper .pag-infoabout-carouselname {
      font-weight: bold;
      margin-top: 2rem; }

.pag-infoabout-ctabutton {
  margin-top: 1rem; }

.pag-infoabout-frame {
  background-color: #fefefe;
  border-top-left-radius: 1rem;
  border-top-right-radius: 1rem;
  margin: 0 0.75rem;
  padding: 1.5rem 1.5rem 0 1.5rem; }

.pag-infoabout-heroimg {
  max-height: 70vh;
  width: 100vw;
  object-fit: cover;
  margin-bottom: 2rem; }

.pag-infoabout-grid > .column, .pag-infoabout-grid > .columns {
  padding-bottom: 0; }

.pag-infoabout-image {
  width: 100%; }

.pag-infoabout-fastfactcontainer {
  gap: 1.5rem;
  padding-bottom: 4rem;
  margin-top: 1rem; }
  @media only screen and (min-width: 960px) {
    .pag-infoabout-fastfactcontainer {
      gap: 3rem; } }

.pag-infoabout-fastfactwrapper {
  text-align: start;
  width: 100%;
  padding: 1.5rem;
  -ms-flex-pack: justify;
      justify-content: space-between;
  background-color: #fefefe; }
  @media only screen and (min-width: 960px) {
    .pag-infoabout-fastfactwrapper {
      width: 12rem; } }
  @media only screen and (min-width: 960px) {
    .pag-infoabout-fastfactwrapper {
      height: 12rem; } }

.pag-infoabout-logoswrapper {
  gap: 3rem;
  -ms-flex-pack: center;
      justify-content: center;
  margin-top: 2.5rem; }

.pag-infoabout-logoswrapper {
  gap: 3rem;
  -ms-flex-pack: center;
      justify-content: center;
  margin-top: 2.5rem; }

.pag-infoabout-logoitem {
  max-height: 2.5rem;
  max-width: 2.5rem;
  object-fit: contain; }

.pag-infoabout-section {
  padding-top: 1.5rem;
  text-align: justify;
  padding-bottom: 1.5rem; }
  @media only screen and (min-width: 960px) {
    .pag-infoabout-section {
      padding-top: 4rem; } }
  @media only screen and (min-width: 960px) {
    .pag-infoabout-section {
      padding-bottom: 4rem; } }
  .pag-infoabout-section.colored {
    background-color: #fefefe; }
  .pag-infoabout-section.centered {
    text-align: center; }
  @media only screen and (min-width: 960px) {
    .pag-infoabout-section.about {
      padding: 6rem 18rem 1rem 18rem; } }
  .pag-infoabout-section.intro .left {
    padding-left: 0; }
    @media only screen and (min-width: 960px) {
      .pag-infoabout-section.intro .left {
        padding-left: inherit; } }
    .pag-infoabout-section.intro .left .pag-infoabout-miniheroimg {
      aspect-ratio: 2/3;
      object-fit: cover;
      margin-top: 3rem;
      margin-right: 2rem;
      max-width: 100%; }
      @media only screen and (min-width: 960px) {
        .pag-infoabout-section.intro .left .pag-infoabout-miniheroimg {
          max-width: 25rem; } }
      @media only screen and (min-width: 960px) {
        .pag-infoabout-section.intro .left .pag-infoabout-miniheroimg {
          -ms-flex-item-align: end;
              align-self: flex-end; } }
  .pag-infoabout-section.intro .right {
    padding-left: 0;
    margin-top: 0;
    padding-right: 0; }
    @media only screen and (min-width: 960px) {
      .pag-infoabout-section.intro .right {
        padding-left: 3rem; } }
    @media only screen and (min-width: 960px) {
      .pag-infoabout-section.intro .right {
        margin-top: 18rem; } }
    @media only screen and (min-width: 960px) {
      .pag-infoabout-section.intro .right {
        padding-right: 8rem; } }
  .pag-infoabout-section.testimonialintro {
    margin-bottom: 0;
    padding-bottom: 0; }
    @media only screen and (min-width: 960px) {
      .pag-infoabout-section.testimonialintro {
        margin-bottom: -2rem; } }

.pag-infoabout-team.row {
  margin-top: 1rem; }

.pag-infoabout-teamwrapper {
  height: 17rem; }

.pag-infoabout-text {
  margin-top: 1rem; }

.pag-infoabout-textamname {
  font-size: 0.875rem;
  font-weight: bold;
  text-transform: uppercase; }

.pag-infoabout-teamphoto {
  background-position: center;
  background-repeat: no-repeat;
  background-size: cover;
  height: 12rem;
  width: 100%; }

.pag-infoabout-teamname {
  font-weight: bold; }

.pag-infoabout-teamrole {
  color: #555;
  font-size: 0.875rem; }

.pag-infoabout-teamtexts {
  padding: 0.5rem 0.75rem;
  text-align: start;
  height: 5rem; }

.pag-infoabout-title {
  margin-bottom: 0.75rem; }

.pag-infoabout-testimonialimage {
  width: 8rem;
  height: 8rem;
  border-radius: 50%;
  margin-bottom: 1rem; }

.pag-infoabout-testimonialname {
  font-weight: bold;
  margin-top: 1rem;
  margin-bottom: 0.25rem; }

.pag-infoabout-testimonialcaption {
  font-size: 0.875rem; }

.pag-infoabout-yt {
  margin-top: 1.5rem;
  width: 100%;
  height: 20rem; }
  @media only screen and (min-width: 960px) {
    .pag-infoabout-yt {
      width: 90%; } }

.pag-infoabout-video {
  height: 0;
  padding-top: 56.25%;
  position: relative;
  text-align: center;
  width: 100%; }
  .pag-infoabout-video iframe {
    position: absolute;
    top: 0;
    left: 0;
    width: 100%;
    height: 100%; }

.pag-infopartnerships-content {
  margin: 2rem 0 1rem 0; }
  .pag-infopartnerships-content img {
    margin-bottom: 0.5rem; }

.pag-infopartnerships-headersection {
  color: #fefefe;
  position: relative;
  background-repeat: no-repeat;
  background-position: center;
  background-size: cover;
  width: 100%;
  padding-bottom: 400px;
  text-align: center; }
  .pag-infopartnerships-headersectioncontent {
    left: 0;
    margin: 0 auto;
    right: 0;
    position: absolute; }
    .pag-infopartnerships-headersectioncontent.middle {
      top: 50%;
      -ms-transform: translateY(-50%);
          transform: translateY(-50%); }

.pag-infopartnerships-intro {
  color: #757575;
  margin: 2rem 0 1rem 0;
  text-align: center; }

.pag-infopartnerships-photo {
  background-color: #fefefe;
  background-position: center;
  background-repeat: no-repeat;
  background-size: cover;
  border-radius: 50%;
  height: 7rem;
  margin: 0 auto;
  width: 7rem; }
  @media only screen and (min-width: 1280px) {
    .pag-infopartnerships-photo {
      height: 10rem; } }
  @media only screen and (min-width: 1280px) {
    .pag-infopartnerships-photo {
      width: 10rem; } }

.pag-infopolicies .button {
  margin: 0.5rem 0.25rem 0 0; }

.pag-infopolicies-section {
  margin-bottom: 1.5rem; }
  @media only screen and (min-width: 960px) {
    .pag-infopolicies-section {
      margin-bottom: 2rem; } }
  @media only screen and (min-width: 1280px) {
    .pag-infopolicies-section {
      margin-bottom: 2.5rem; } }
  .pag-infopolicies-section p {
    text-align: justify; }

.pag-infopolicies-subtitle {
  margin-bottom: 0.2rem;
  margin-top: 0.5rem; }
  .pag-infopolicies-subtitle.main {
    text-transform: uppercase; }

.pag-infopolicies-title {
  margin: 3rem auto 1.5rem auto;
  text-align: center; }

.pag-infopress-grid {
  margin-bottom: 2.6rem; }
  .pag-infopress-grid p {
    text-align: center; }
  .pag-infopress-grid .fa {
    color: #555;
    font-size: 3.2rem; }
  .pag-infopress-grid .button {
    margin-bottom: 0;
    margin-top: 0.5rem; }

.pag-infopress-image {
  margin-left: auto;
  margin-right: auto;
  padding-bottom: 0.65rem;
  text-align: center;
  width: 100%; }
  @media only screen and (min-width: 960px) {
    .pag-infopress-image {
      width: 25%; } }
  .pag-infopress-image img {
    width: 100%;
    height: auto; }
  .pag-infopress-image.left {
    float: left; }
    @media only screen and (min-width: 960px) {
      .pag-infopress-image.left {
        padding-right: 1.3rem; } }
  .pag-infopress-image.right {
    float: right; }
    @media only screen and (min-width: 960px) {
      .pag-infopress-image.right {
        padding-left: 1.3rem; } }
  @media only screen and (min-width: 960px) {
    .pag-infopress-image.wide {
      width: 50%; } }

.pag-infopress-intro {
  color: #757575;
  margin-bottom: 1.5rem;
  text-align: center; }

.pag-infopress-kit {
  margin: 3rem 0 6rem 0;
  text-align: center; }
  .pag-infopress-kit .fa {
    color: #555;
    font-size: 2.4rem;
    margin-right: 1rem;
    position: relative;
    top: 0.4rem; }
  .pag-infopress-kit .button {
    margin: 0 0 0 1rem; }

.pag-infopress-linktitle {
  margin: 0.5rem 0 0.25rem; }

.pag-infopress-list {
  margin-top: 0.5rem; }

.pag-infopress-post {
  margin-bottom: 3.5rem; }

.pag-infopress-postauthor {
  margin-bottom: 0; }

.pag-infopress-postcontent {
  margin: 0;
  text-align: justify; }

.pag-infopress-postheading {
  margin-bottom: 0.875rem; }

.pag-infopress-posttime {
  color: #aaa; }

.pag-infopress-postphoto {
  background-color: #fefefe;
  background-position: center;
  background-repeat: no-repeat;
  background-size: cover;
  border-radius: 50%;
  height: 4rem;
  margin: 0 auto;
  width: 4rem; }

.pag-infopress-postrole {
  color: #aaa;
  margin-bottom: 0; }

.pag-infopress-postsocials {
  clear: both; }

.pag-infopress-section {
  margin-bottom: 1.5rem; }
  @media only screen and (min-width: 960px) {
    .pag-infopress-section {
      margin-bottom: 2rem; } }
  @media only screen and (min-width: 1280px) {
    .pag-infopress-section {
      margin-bottom: 2.5rem; } }

.pag-infopress-subtitle {
  margin-bottom: 0.5rem;
  margin-top: 2rem; }
  .pag-infopress-subtitle.main {
    text-transform: uppercase; }

.pag-infopress-title {
  margin: 3rem auto 1.5rem auto;
  text-align: center; }

.pag-inhousehireform {
  background-color: #757575;
  background-clip: content-box;
  background-position: top center;
  background-repeat: no-repeat;
  background-size: cover;
  height: 100vh; }
  @media only screen and (min-width: 640px) {
    .pag-inhousehireform {
      background-position: top left; } }
  .pag-inhousehireform .lyt-content {
    margin: 0 auto;
    padding: 0.5rem 0.5rem 0;
    position: relative; }
    @media only screen and (min-width: 640px) {
      .pag-inhousehireform .lyt-content {
        padding: 4rem 0.5rem 0; } }
    @media only screen and (min-width: 640px) {
      .pag-inhousehireform .lyt-content {
        width: 42rem; } }
  .pag-inhousehireform .cmp-inputiconed input[type=text] {
    padding-left: 0.75rem !important;
    padding-right: 0.75rem !important; }
  .pag-inhousehireform .cmp-inputiconed-icon {
    display: none; }

.pag-inhousehireform-availability {
  color: #757575;
  font-size: 0.875rem;
  margin-bottom: 0.5rem;
  padding: 0 1rem; }

@media only screen and (min-width: 640px) {
  .pag-inhousehireform-back {
    left: 2rem; } }

@media only screen and (min-width: 640px) {
  .pag-inhousehireform-back {
    position: absolute; } }

@media only screen and (min-width: 640px) {
  .pag-inhousehireform-back {
    top: 1rem; } }

.pag-inhousehireform-back i {
  font-size: 1.5rem; }

.pag-inhousehireform-buttons {
  margin: 1rem auto 0 auto;
  text-align: center; }

.pag-inhousehireform-detail {
  font-size: 0.875rem;
  margin-bottom: 0.5rem; }

.pag-inhousehireform-detailimage {
  margin-left: 0.5rem;
  max-width: 10rem;
  vertical-align: top; }

.pag-inhousehireform-fields .row {
  margin-right: -0.25rem;
  margin-left: -0.25rem; }
  @media only screen and (min-width: 640px) {
    .pag-inhousehireform-fields .row {
      margin-right: -0.5rem; } }
  @media only screen and (min-width: 640px) {
    .pag-inhousehireform-fields .row {
      margin-left: -0.5rem; } }
  .pag-inhousehireform-fields .row .column, .pag-inhousehireform-fields .row .columns {
    padding: 0.25rem; }
    @media only screen and (min-width: 640px) {
      .pag-inhousehireform-fields .row .column, .pag-inhousehireform-fields .row .columns {
        padding: 0.5rem; } }

.pag-inhousehireform-links {
  margin-top: 1rem; }
  .pag-inhousehireform-links a {
    display: block; }
  .pag-inhousehireform-links .disabled {
    color: #aaa;
    cursor: default;
    pointer-events: none; }

.pag-inhousehireform-main.column, .pag-inhousehireform-main.columns {
  background-color: #fefefe;
  padding: 1rem; }
  @media only screen and (min-width: 640px) {
    .pag-inhousehireform-main.column, .pag-inhousehireform-main.columns {
      border-bottom-right-radius: 2px; } }
  @media only screen and (min-width: 640px) {
    .pag-inhousehireform-main.column, .pag-inhousehireform-main.columns {
      border-top-right-radius: 2px; } }
  @media only screen and (min-width: 640px) {
    .pag-inhousehireform-main.column, .pag-inhousehireform-main.columns {
      min-height: 31.5rem; } }

.pag-inhousehireform-previewtitle {
  margin: 1.5rem 0 0.5rem 0;
  text-transform: uppercase; }

.pag-inhousehireform-side.column, .pag-inhousehireform-side.columns {
  padding: 1rem; }
  @media only screen and (min-width: 640px) {
    .pag-inhousehireform-side.column, .pag-inhousehireform-side.columns {
      padding: 1rem 2rem; } }
  @media only screen and (min-width: 640px) {
    .pag-inhousehireform-side.column, .pag-inhousehireform-side.columns {
      position: relative; } }

.pag-inhousehireform-sided.row {
  background-color: #eee;
  margin-left: 0;
  margin-right: 0; }

.pag-inhousehireform-status {
  color: red;
  font-size: 0.875rem;
  padding: 0 1rem; }

.pag-inhousehireform-subtitle {
  margin-bottom: 0.75rem;
  text-transform: uppercase; }

.pag-inhousehireform-title {
  margin: 0;
  text-transform: uppercase; }
  @media only screen and (min-width: 640px) {
    .pag-inhousehireform-title {
      margin: 3rem 0 1.5rem; } }

.pag-invoiceslist-section {
  margin: 1.25rem 0 2.5rem; }

.pag-messagecenter-legend > .row {
  border-bottom: 1px solid #ccc; }

.pag-messagecenter-legendicon {
  margin-right: 0.4rem;
  position: relative;
  top: 0.05rem; }

.pag-messagecenter-legendlink {
  text-transform: uppercase; }

.pag-messagecenter-legendsort {
  cursor: pointer; }

.pag-messagecenter-legendtext {
  color: #aaa;
  text-transform: uppercase; }

.pag-messagecenter-table {
  margin-bottom: 3rem;
  margin-top: 1.5rem; }
  @media only screen and (min-width: 640px) {
    .pag-messagecenter-table {
      min-width: 40rem; } }
  .pag-messagecenter-table > .row {
    border-bottom: 1px solid #ccc;
    position: relative; }
    .pag-messagecenter-table > .row:last-child {
      border-bottom: none; }
    .pag-messagecenter-table > .row > .column, .pag-messagecenter-table > .row > .columns {
      padding-top: 0.5rem;
      padding-bottom: 0.5rem; }
      @media only screen and (min-width: 640px) {
        .pag-messagecenter-table > .row > .column, .pag-messagecenter-table > .row > .columns {
          padding-top: 1rem; } }
      @media only screen and (min-width: 640px) {
        .pag-messagecenter-table > .row > .column, .pag-messagecenter-table > .row > .columns {
          padding-bottom: 1rem; } }

.pag-messagecenter-title {
  margin-bottom: 0.5rem;
  margin-right: 1rem;
  text-transform: uppercase; }
  @media only screen and (min-width: 640px) {
    .pag-messagecenter-title {
      display: inline-block; } }

.pag-messagecenter .tabs-title {
  position: relative; }

.pag-messagecenter-actions {
  margin-top: 1rem; }

.pag-messagecenter-circle {
  background-color: #e75635;
  border-radius: 50%;
  color: #fefefe;
  font-size: 0.875rem;
  height: 1.25rem;
  line-height: 1.65;
  position: absolute;
  right: 0.85rem;
  text-align: center;
  top: 1rem;
  width: 1.25rem; }
  .pag-messagecenter-circle + .pag-messagecenter-name {
    padding-right: 2.25rem; }

.pag-messagecenter-comment {
  color: #757575;
  padding: 1rem; }

.pag-messagecenter-form {
  display: inline-block; }

.pag-notification-content p {
  margin-bottom: 1rem; }

.pag-notification-content ul {
  margin-bottom: 0.5rem; }
  .pag-notification-content ul li {
    margin-bottom: 0.25rem; }

.pag-notification-heading {
  padding: 1rem 0; }

.pag-notification-tips {
  margin-top: 2rem;
  text-align: center; }
  @media only screen and (min-width: 640px) {
    .pag-notification-tips {
      margin-top: 6rem; } }
  @media only screen and (min-width: 960px) {
    .pag-notification-tips {
      margin-top: 10rem; } }

.pag-notification-tipsbutton {
  margin-top: 1.75rem;
  min-width: 12rem; }

.pag-notification-tipsicon {
  color: #ccc;
  font-size: 5rem;
  margin-bottom: 1.75rem; }

.pag-notification-title {
  font-weight: bold;
  text-transform: uppercase; }

.pag-organization .tabs {
  margin-bottom: 2.5rem; }

.pag-organization-actionswrapper {
  margin-top: 1rem;
  margin-bottom: 0.5rem; }

.pag-organization-error {
  color: #cc4b37;
  font-size: 0.875rem; }

.pag-organization-divider {
  margin-top: 1rem;
  color: #757575; }

.pag-organization-form [type='file'] {
  width: auto; }

.pag-organization-invoices {
  margin-bottom: 0.5rem; }

.pag-organization-items {
  scrollbar-width: thin;
  scrollbar-color: #e3e3e3 transparent;
  overflow-x: scroll;
  white-space: nowrap;
  margin: 1rem -0.625rem; }
  .pag-organization-items::-webkit-scrollbar {
    height: 6px; }
  .pag-organization-items::-webkit-scrollbar-thumb {
    background-color: #e3e3e3;
    border-radius: 2px; }

.pag-organization-list li {
  margin-bottom: 0.5rem; }

.pag-organization-member {
  margin-bottom: 0.5rem;
  -ms-flex-align: center;
      align-items: center;
  padding: 0.75rem 0; }

.pag-organization-memberaddwrapper {
  margin-bottom: 1rem; }

.pag-organization-memberdivider {
  height: 1px;
  background-color: #e3e3e3;
  width: 100%; }

.pag-organization-memberbutton {
  padding: 0.25rem 0.4rem; }

.pag-organization-memberinlineform {
  display: inline-block; }

.pag-organization-memberinfo {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap; }

.pag-organization-memberthumb {
  width: 2.5rem;
  height: 2.5rem;
  -ms-flex-pack: center;
      justify-content: center;
  -ms-flex-align: center;
      align-items: center;
  border-radius: 50%;
  font-weight: bold; }

.pag-organization-memberuser {
  margin-bottom: 0.2rem; }

.pag-organization-memberwrapper {
  width: 100%;
  margin-top: 1rem; }

.pag-organization-preapprove.gray {
  color: #757575;
  font-size: 0.875rem; }

.pag-organization-preapprove.warn {
  color: #ffae00; }

.pag-organization-preapprove.ok {
  color: #66c17b; }

.pag-organization-preapprovewrapper {
  margin-top: 0.5rem; }

.pag-organization-section {
  margin-bottom: 2rem; }
  @media only screen and (min-width: 640px) {
    .pag-organization-section {
      margin-bottom: 4rem; } }

.pag-organization-sectiontitle {
  margin-bottom: 0.75rem; }

.pag-organization-tablink i {
  font-size: 0.75rem;
  font-weight: bold; }

.pag-organization-title {
  margin-bottom: 2.75rem; }

.pag-organization-venue {
  margin-top: 1rem; }

.pag-packagerentaldetail .lyt-sided {
  margin: 0.75rem auto 0;
  padding: 0 0.75rem; }
  @media only screen and (min-width: 960px) {
    .pag-packagerentaldetail .lyt-sided {
      margin: 1.25rem auto 0; } }
  @media only screen and (min-width: 640px) {
    .pag-packagerentaldetail .lyt-sided {
      max-width: 640px; } }
  @media only screen and (min-width: 960px) {
    .pag-packagerentaldetail .lyt-sided {
      max-width: 920px; } }
  @media only screen and (min-width: 1280px) {
    .pag-packagerentaldetail .lyt-sided {
      max-width: 1160px; } }
  @media only screen and (min-width: 1600px) {
    .pag-packagerentaldetail .lyt-sided {
      max-width: 1160px; } }
  @media only screen and (min-width: 640px) {
    .pag-packagerentaldetail .lyt-sided {
      padding: 0 20px; } }

@media only screen and (min-width: 960px) {
  .pag-packagerentaldetail .lyt-sided {
    position: relative; } }

@media only screen and (min-width: 960px) {
  .pag-packagerentaldetail .lyt-sided:after {
    content: ""; } }

@media only screen and (min-width: 960px) {
  .pag-packagerentaldetail .lyt-sided:after {
    display: table; } }

@media only screen and (min-width: 960px) {
  .pag-packagerentaldetail .lyt-sided:after {
    clear: both; } }

.pag-packagerentaldetail .lyt-sided .lyt-sided-aside {
  width: 100%; }
  @media only screen and (min-width: 960px) {
    .pag-packagerentaldetail .lyt-sided .lyt-sided-aside {
      float: right; } }
  @media only screen and (min-width: 960px) {
    .pag-packagerentaldetail .lyt-sided .lyt-sided-aside {
      width: 320px; } }
  .pag-packagerentaldetail .lyt-sided .lyt-sided-aside + .lyt-sided-main {
    margin-top: 2.5rem; }
    @media only screen and (min-width: 960px) {
      .pag-packagerentaldetail .lyt-sided .lyt-sided-aside + .lyt-sided-main {
        margin-top: 0; } }

.pag-packagerentaldetail .lyt-sided .lyt-sided-main {
  width: 100%; }
  @media only screen and (min-width: 960px) {
    .pag-packagerentaldetail .lyt-sided .lyt-sided-main {
      float: left; } }
  @media only screen and (min-width: 960px) {
    .pag-packagerentaldetail .lyt-sided .lyt-sided-main {
      width: 520px; } }
  @media only screen and (min-width: 1280px) {
    .pag-packagerentaldetail .lyt-sided .lyt-sided-main {
      width: 760px; } }
  @media only screen and (min-width: 1600px) {
    .pag-packagerentaldetail .lyt-sided .lyt-sided-main {
      width: 760px; } }
  .pag-packagerentaldetail .lyt-sided .lyt-sided-main + .lyt-sided-aside {
    margin-top: 2.5rem; }
    @media only screen and (min-width: 960px) {
      .pag-packagerentaldetail .lyt-sided .lyt-sided-main + .lyt-sided-aside {
        margin-top: 0; } }
    @media only screen and (min-width: 1280px) {
      .pag-packagerentaldetail .lyt-sided .lyt-sided-main + .lyt-sided-aside .lyt-sided-aside-fixed {
        position: fixed; } }
    @media only screen and (min-width: 1280px) {
      .pag-packagerentaldetail .lyt-sided .lyt-sided-main + .lyt-sided-aside .lyt-sided-aside-fixed {
        width: 320px; } }

.pag-packagerentaldetail .cmp-assistantsection {
  padding: 2.5rem 0; }
  @media only screen and (min-width: 640px) {
    .pag-packagerentaldetail .cmp-assistantsection {
      padding: 2.5rem 0.625rem; } }

.pag-packagerentaldetail-accordion {
  margin-left: -1rem; }

.pag-packagerentaldetail-next {
  margin-bottom: 2rem; }

.pag-packagerentaldetail-nexticon {
  display: none;
  position: absolute;
  text-align: center;
  width: 3rem; }
  @media only screen and (min-width: 640px) {
    .pag-packagerentaldetail-nexticon {
      display: block; } }
  .pag-packagerentaldetail-nexticon .fa {
    font-size: 2rem; }
  @media only screen and (min-width: 640px) {
    .pag-packagerentaldetail-nexticon + .pag-packagerentaldetail-nexttexts {
      margin-left: 3.5rem; } }

.pag-packagerentaldetail-nexttitle {
  margin-bottom: 0.5rem; }

.pag-packagerentaldetail-note {
  margin-bottom: 0.75rem; }

.pag-packagerentaldetail-recaptitle {
  margin-bottom: 1rem; }

@media only screen and (min-width: 1280px) {
  .pag-passwordreset {
    min-height: 30rem; } }

.pag-passwordreset-closebutton {
  margin-top: 1rem; }

.pag-passwordreset-closetext {
  margin-bottom: 1rem; }

.pag-passwordreset-formwrapper {
  margin-left: 0; }

.pag-passwordreset-headertext {
  font-weight: bold; }

.pag-passwordreset-logo {
  width: 6rem; }

.pag-passwordreset {
  -ms-flex-pack: center;
      justify-content: center;
  -ms-flex-align: center;
      align-items: center; }

.pag-passwordreset {
  position: relative; }

.pag-passwordreset-image {
  height: 100%;
  object-fit: cover;
  position: absolute;
  width: 100%; }

.pag-passwordreset-subcontainer {
  z-index: 100;
  padding: 1.5rem 0.5rem 0 0.5rem;
  margin: 1.5rem; }
  @media only screen and (min-width: 640px) {
    .pag-passwordreset-subcontainer {
      margin: 3rem; } }

.pag-passwordreset-subcontainerpadded {
  z-index: 100;
  padding: 1.5rem;
  margin: 1.5rem; }
  @media only screen and (min-width: 640px) {
    .pag-passwordreset-subcontainerpadded {
      padding: 3rem; } }
  @media only screen and (min-width: 640px) {
    .pag-passwordreset-subcontainerpadded {
      margin: 3rem; } }

.pag-passwordreset-revealactionswrapper.lyt-actions {
  text-align: left; }
  .pag-passwordreset-revealactionswrapper.lyt-actions .button {
    margin-left: 0; }

.pag-passwordreset-revealcontentwrapper {
  row-gap: 1rem; }

.pag-passwordreset-subtext {
  margin-top: 0.25rem;
  color: #757575; }

.pag-paymentupdate .lyt-sided {
  margin: 0.75rem auto 0;
  padding: 0 0.75rem; }
  @media only screen and (min-width: 960px) {
    .pag-paymentupdate .lyt-sided {
      margin: 1.25rem auto 0; } }
  @media only screen and (min-width: 640px) {
    .pag-paymentupdate .lyt-sided {
      max-width: 640px; } }
  @media only screen and (min-width: 960px) {
    .pag-paymentupdate .lyt-sided {
      max-width: 920px; } }
  @media only screen and (min-width: 1280px) {
    .pag-paymentupdate .lyt-sided {
      max-width: 1160px; } }
  @media only screen and (min-width: 1600px) {
    .pag-paymentupdate .lyt-sided {
      max-width: 1160px; } }
  @media only screen and (min-width: 640px) {
    .pag-paymentupdate .lyt-sided {
      padding: 0 20px; } }

@media only screen and (min-width: 960px) {
  .pag-paymentupdate .lyt-sided {
    position: relative; } }

@media only screen and (min-width: 960px) {
  .pag-paymentupdate .lyt-sided:after {
    content: ""; } }

@media only screen and (min-width: 960px) {
  .pag-paymentupdate .lyt-sided:after {
    display: table; } }

@media only screen and (min-width: 960px) {
  .pag-paymentupdate .lyt-sided:after {
    clear: both; } }

.pag-paymentupdate .lyt-sided .lyt-sided-aside {
  width: 100%; }
  @media only screen and (min-width: 960px) {
    .pag-paymentupdate .lyt-sided .lyt-sided-aside {
      float: right; } }
  @media only screen and (min-width: 960px) {
    .pag-paymentupdate .lyt-sided .lyt-sided-aside {
      width: 320px; } }
  .pag-paymentupdate .lyt-sided .lyt-sided-aside + .lyt-sided-main {
    margin-top: 2.5rem; }
    @media only screen and (min-width: 960px) {
      .pag-paymentupdate .lyt-sided .lyt-sided-aside + .lyt-sided-main {
        margin-top: 0; } }

.pag-paymentupdate .lyt-sided .lyt-sided-main {
  width: 100%; }
  @media only screen and (min-width: 960px) {
    .pag-paymentupdate .lyt-sided .lyt-sided-main {
      float: left; } }
  @media only screen and (min-width: 960px) {
    .pag-paymentupdate .lyt-sided .lyt-sided-main {
      width: 520px; } }
  @media only screen and (min-width: 1280px) {
    .pag-paymentupdate .lyt-sided .lyt-sided-main {
      width: 760px; } }
  @media only screen and (min-width: 1600px) {
    .pag-paymentupdate .lyt-sided .lyt-sided-main {
      width: 760px; } }
  .pag-paymentupdate .lyt-sided .lyt-sided-main + .lyt-sided-aside {
    margin-top: 2.5rem; }
    @media only screen and (min-width: 960px) {
      .pag-paymentupdate .lyt-sided .lyt-sided-main + .lyt-sided-aside {
        margin-top: 0; } }
    @media only screen and (min-width: 1280px) {
      .pag-paymentupdate .lyt-sided .lyt-sided-main + .lyt-sided-aside .lyt-sided-aside-fixed {
        position: fixed; } }
    @media only screen and (min-width: 1280px) {
      .pag-paymentupdate .lyt-sided .lyt-sided-main + .lyt-sided-aside .lyt-sided-aside-fixed {
        width: 320px; } }

.pag-paymentupdate .cmp-tilebooking {
  margin-bottom: 2.5rem; }

.pag-paymentupdate-button {
  min-width: 10rem; }

.pag-paymentupdate-title {
  margin-bottom: 2.5rem; }

.pag-paymentupdate-section {
  margin-bottom: 1.25rem; }
  @media only screen and (min-width: 960px) {
    .pag-paymentupdate-section {
      margin-bottom: 2.5rem; } }

.pag-paymentupdate-sectiontitle {
  margin-bottom: 0.5rem; }

.pag-payoutlist-help {
  background-color: #50aaeb;
  background-repeat: no-repeat;
  background-position: center center;
  background-attachment: scroll;
  background-size: cover;
  color: #fefefe;
  margin: 0 0 2rem;
  padding: 0.75rem 1.25rem; }
  .pag-payoutlist-help a {
    color: #fefefe;
    text-decoration: underline; }

.pag-payoutlist-helpbutton {
  display: block;
  margin-top: 0.25rem; }

.pag-payoutlist-helptext {
  margin-top: 0.25rem; }

.pag-payoutlist-helptitle {
  font-weight: bold; }

.pag-placedetail .breadcrumbs a {
  display: inline-block;
  padding-bottom: 0.5rem; }

.pag-placedetail .cmp-emailtip {
  background-color: #e3e3e3;
  position: absolute;
  z-index: 100; }

.pag-placedetail .cmp-footersection {
  margin-bottom: 5.75rem; }

.pag-placedetail .cmp-inputiconed-icon {
  display: block; }

.pag-placedetail .cmp-navigation:not(.sticky) {
  z-index: 200; }
  @media only screen and (min-width: 960px) {
    .pag-placedetail .cmp-navigation:not(.sticky) {
      background-color: transparent; } }
  @media only screen and (min-width: 960px) {
    .pag-placedetail .cmp-navigation:not(.sticky) .top-bar {
      background-color: transparent; } }
  @media only screen and (min-width: 960px) {
    .pag-placedetail .cmp-navigation:not(.sticky) .top-bar {
      box-shadow: none; } }
  @media only screen and (min-width: 1280px) {
    .pag-placedetail .cmp-navigation:not(.sticky) .top-bar {
      margin: 0 auto; } }
  @media only screen and (min-width: 1280px) {
    .pag-placedetail .cmp-navigation:not(.sticky) .top-bar {
      max-width: 90rem; } }

.pag-placedetail-accordioncontent {
  padding-left: 2.25rem;
  padding-top: 0.75rem; }
  .pag-placedetail-accordioncontent.spacedsubsections > div {
    padding-bottom: 1.5rem; }

.pag-placedetail-accordionitem {
  margin-bottom: 0; }

.pag-placedetail-accordiontitle {
  line-height: 2.25;
  padding: 0; }

.pag-placedetail-accordiontitleicon {
  position: relative;
  top: 0.325rem; }

@media only screen and (min-width: 640px) {
  .pag-placedetail-assistant {
    position: relative; } }

.pag-placedetail-assistantaside {
  padding: 0.5rem 0.75rem; }
  @media only screen and (min-width: 640px) {
    .pag-placedetail-assistantaside {
      bottom: auto; } }
  @media only screen and (min-width: 640px) {
    .pag-placedetail-assistantaside {
      padding: 1rem 1.5rem; } }
  @media only screen and (min-width: 640px) {
    .pag-placedetail-assistantaside {
      position: absolute; } }
  @media only screen and (min-width: 640px) {
    .pag-placedetail-assistantaside {
      right: 0; } }
  @media only screen and (min-width: 640px) {
    .pag-placedetail-assistantaside {
      top: 0; } }
  @media only screen and (min-width: 640px) {
    .pag-placedetail-assistantaside {
      width: 8rem; } }

.pag-placedetail-assistantmain {
  padding: 0.5rem 0.75rem; }
  @media only screen and (min-width: 640px) {
    .pag-placedetail-assistantmain {
      margin-right: 8rem; } }
  @media only screen and (min-width: 640px) {
    .pag-placedetail-assistantmain {
      padding: 1rem 1.5rem; } }

.pag-placedetail-assistantphoto {
  background-color: #fefefe;
  background-position: center;
  background-repeat: no-repeat;
  background-size: cover;
  border-radius: 50%;
  height: 5rem;
  width: 5rem; }

.pag-placedetail-assistanttext {
  margin-bottom: 0.5rem; }

.pag-placedetail-availability {
  padding-left: 0.125rem;
  padding-right: 0.125rem; }
  @media only screen and (min-width: 640px) {
    .pag-placedetail-availability {
      padding-left: 0; } }
  @media only screen and (min-width: 640px) {
    .pag-placedetail-availability {
      padding-right: 0; } }

.pag-placedetail-availabilityblink {
  animation-duration: 2s;
  animation-iteration-count: infinite;
  animation-name: blink;
  background-color: #50aaeb;
  border-radius: 50%;
  display: inline-block;
  height: 0.75rem;
  margin: 0 0.15rem;
  position: relative;
  top: 0.05rem;
  width: 0.75rem; }

@keyframes blink {
  0% {
    opacity: 1; }
  50% {
    opacity: 0; }
  100% {
    opacity: 1; } }

.pag-placedetail-availabilitylabel {
  color: #757575;
  display: inline-block;
  font-size: 0.875rem;
  min-width: 1.75rem; }

.pag-placedetail-availabilitylegend {
  padding-top: 1rem;
  text-align: center; }

.pag-placedetail-availabilitylegendcomment {
  display: inline-block;
  margin-left: 0.5rem;
  margin-right: 2rem; }

.pag-placedetail-availabilitylegendswatch {
  border: 1px solid #ddd;
  border-radius: 50%;
  display: inline-block;
  height: 1rem;
  position: relative;
  top: 0.1rem;
  width: 1rem; }
  .pag-placedetail-availabilitylegendswatch.available {
    background-color: #fefefe; }
  .pag-placedetail-availabilitylegendswatch.closed {
    background-color: #eee; }
  .pag-placedetail-availabilitylegendswatch.unavailable {
    background-color: #ccc; }

.pag-placedetail-availabilitylive {
  color: #757575;
  display: inline-block;
  font-size: 0.875rem; }

.pag-placedetail-badge {
  display: inline-block;
  padding: 0.4rem 1.5rem 0.4rem 0;
  vertical-align: top; }

.pag-placedetail-badgeimage {
  height: 2rem;
  width: 2rem; }

.pag-placedetail-badgevalue {
  display: inline-block; }

.pag-placedetail-bannertitle {
  margin-bottom: 0.25rem; }

.pag-placedetail-bannertext {
  margin-bottom: 0.25rem; }

.pag-placedetail-bannerwrapper {
  background-color: rgba(170, 170, 170, 0.15);
  margin-bottom: 4rem;
  padding: 0.75rem 1.5rem; }
  .pag-placedetail-bannerwrapper.alert {
    background-color: rgba(204, 75, 55, 0.15); }
  .pag-placedetail-bannerwrapper.success-dark {
    background-color: rgba(102, 193, 123, 0.45); }
  .pag-placedetail-bannerwrapper.success {
    background-color: rgba(102, 193, 123, 0.15); }
  .pag-placedetail-bannerwrapper.warning {
    background-color: rgba(255, 174, 0, 0.15); }
  .pag-placedetail-bannerwrapper form {
    display: inline-block; }

.pag-placedetail-contactcard {
  margin-top: 0.75rem;
  padding: 0.5rem 0.75rem; }
  @media only screen and (min-width: 640px) {
    .pag-placedetail-contactcard {
      padding: 1rem 1.5rem; } }

.pag-placedetail-contactintro {
  margin: 0.75rem 0; }

.pag-placedetail-contacttag {
  background-color: #aaa;
  border-radius: 1rem;
  color: #fefefe;
  display: inline-block;
  font-size: 0.875rem;
  padding: 0.2rem 0.7rem 0.1rem;
  margin: 0 0.5rem 0 0; }

.pag-placedetail-contacttag.alert {
  background-color: #cc4b37; }

.pag-placedetail-contacttag.success {
  background-color: #66c17b; }

.pag-placedetail-contacttag.warning {
  background-color: #ffae00; }

.pag-placedetail-conversation {
  padding-bottom: 0.5rem; }

.pag-placedetail-description p:not(:empty):not(:last-child) {
  margin-bottom: 0.5rem; }

.pag-placedetail-description br {
  line-height: 150%; }

.pag-placedetail-extrascategory + .pag-placedetail-extrascategory {
  margin-top: 1.25rem; }

.pag-placedetail-extrasintro {
  margin: 0 0 0.45rem 0; }

.pag-placedetail-extrasmore {
  display: block;
  padding-left: 0.5rem;
  text-transform: lowercase; }
  .pag-placedetail-extrasmore::first-letter {
    text-transform: uppercase; }

.pag-placedetail-faq {
  margin-bottom: 2rem; }
  @media only screen and (min-width: 640px) {
    .pag-placedetail-faq {
      position: relative; } }
  .pag-placedetail-faqaside {
    padding: 0.5rem 0.75rem; }
    @media only screen and (min-width: 640px) {
      .pag-placedetail-faqaside {
        bottom: 0; } }
    @media only screen and (min-width: 640px) {
      .pag-placedetail-faqaside {
        padding: 1rem 1.5rem; } }
    @media only screen and (min-width: 640px) {
      .pag-placedetail-faqaside {
        position: absolute; } }
    @media only screen and (min-width: 640px) {
      .pag-placedetail-faqaside {
        right: 0; } }
    @media only screen and (min-width: 640px) {
      .pag-placedetail-faqaside {
        top: 0; } }
    @media only screen and (min-width: 640px) {
      .pag-placedetail-faqaside {
        width: 16rem; } }
  .pag-placedetail-faqmain {
    padding: 0.5rem 0.75rem; }
    @media only screen and (min-width: 640px) {
      .pag-placedetail-faqmain {
        margin-right: 16rem; } }
    @media only screen and (min-width: 640px) {
      .pag-placedetail-faqmain {
        padding: 1rem 1.5rem; } }

@media only screen and (min-width: 640px) {
  .pag-placedetail-faqasidecontent {
    position: absolute; } }

@media only screen and (min-width: 640px) {
  .pag-placedetail-faqasidecontent {
    top: 50%; } }

@media only screen and (min-width: 640px) {
  .pag-placedetail-faqasidecontent {
    -ms-transform: translateY(-50%);
        transform: translateY(-50%); } }

.pag-placedetail-faqasideicon.material-icons {
  font-size: 3rem; }

.pag-placedetail-faqmain {
  padding-left: 0; }

.pag-placedetail-floatingbar {
  background-color: #fefefe;
  bottom: 0;
  box-shadow: 0 -4px 8px 0 rgba(0, 0, 0, 0.12), 0 -8px 24px 0 rgba(0, 0, 0, 0.08);
  height: auto;
  left: 0;
  padding: 0.5rem 1.25rem 0.625rem;
  position: fixed;
  right: 0;
  width: 100%;
  z-index: 400; }

.pag-placedetail-floatingbooking {
  position: absolute;
  right: 1.25rem;
  top: 0.5rem; }

.pag-placedetail-floatingcomment {
  color: #757575;
  font-size: 0.875rem; }

.pag-placedetail-floatingreserve {
  padding: 0.75rem 0 0.125rem; }

.pag-placedetail-highlights.row {
  margin-left: -0.25rem;
  margin-right: -0.25rem; }

.pag-placedetail-highlights .column, .pag-placedetail-highlights .columns {
  padding: 0.25rem; }

.pag-placedetail-introcontent {
  display: inline-block; }

.pag-placedetail-introlink {
  padding-left: 2rem; }

.pag-placedetail-introsubtitle {
  color: #757575;
  margin-top: 0.375rem; }

.pag-placedetail-introtext {
  font-weight: normal;
  margin: 0; }

.pag-placedetail-introtitle {
  margin-bottom: 0.5rem; }

.pag-placedetail-map {
  height: 15rem;
  width: 100%; }
  @media only screen and (min-width: 960px) {
    .pag-placedetail-map {
      height: 30rem; } }

.pag-placedetail-paymentuspgrid {
  max-width: 40rem; }
  .pag-placedetail-paymentuspgrid.grid-margin-y {
    margin-bottom: 0.75rem;
    margin-top: -0.25rem; }
    .pag-placedetail-paymentuspgrid.grid-margin-y > .cell {
      margin-bottom: 0.25rem;
      margin-top: 0.25rem; }

.pag-placedetail-pricingdetail {
  margin-top: 0.35rem; }

.pag-placedetail-promo {
  background-color: #eee;
  background-repeat: no-repeat;
  background-position: center center;
  background-attachment: scroll;
  background-size: cover;
  color: #757575;
  margin: 1.5rem 0 0;
  padding: 0.75rem 1.5rem; }
  .pag-placedetail-promo a {
    color: #757575;
    text-decoration: underline; }

.pag-placedetail-promobutton {
  display: block;
  margin-top: 0.25rem; }

.pag-placedetail-promotext {
  margin-top: 0.25rem; }

.pag-placedetail-promotitle {
  font-weight: bold; }

.pag-placedetail-promotitle {
  margin: 0 !important; }

.pag-placedetail-reviewsgrid {
  scrollbar-width: thin;
  scrollbar-color: #e3e3e3 transparent;
  margin: 1rem -0.625rem;
  overflow-x: scroll;
  white-space: nowrap; }
  .pag-placedetail-reviewsgrid::-webkit-scrollbar {
    height: 6px; }
  .pag-placedetail-reviewsgrid::-webkit-scrollbar-thumb {
    background-color: #e3e3e3;
    border-radius: 2px; }
  .pag-placedetail-reviewsgrid .cmp-reviewelement {
    display: inline-block;
    margin: 0 0.625rem 1rem;
    vertical-align: top;
    width: 24rem;
    white-space: normal; }
  .pag-placedetail-reviewsgrid > div {
    display: inline; }

.pag-placedetail-reviewskpi {
  padding: 0.5rem 0.5rem 0.5rem 0.75rem;
  position: relative; }
  @media only screen and (min-width: 640px) {
    .pag-placedetail-reviewskpi {
      padding: 0.75rem 0.75rem 0.75rem 1.25rem; } }

.pag-placedetail-reviewskpicircle {
  border: 4px solid transparent;
  border-left-color: #e3e3e3;
  border-radius: 50%;
  border-right-color: #e3e3e3;
  border-top-color: #e3e3e3;
  position: absolute;
  height: 100%;
  right: 0;
  top: 0;
  width: 100%; }
  .pag-placedetail-reviewskpicircle.rotate-1 {
    -ms-transform: rotate(22.5deg);
        transform: rotate(22.5deg); }
  .pag-placedetail-reviewskpicircle.rotate-2 {
    -ms-transform: rotate(-157.5deg);
        transform: rotate(-157.5deg); }
  .pag-placedetail-reviewskpicircle.rotate-3 {
    -ms-transform: rotate(112.5deg);
        transform: rotate(112.5deg); }
  .pag-placedetail-reviewskpicircle.rotate-4 {
    -ms-transform: rotate(-67.5deg);
        transform: rotate(-67.5deg); }

.pag-placedetail-reviewskpiicon {
  color: #aaa;
  height: 2.2rem;
  position: absolute;
  right: 0.5rem;
  text-align: center;
  top: 0.5rem;
  width: 2.2rem; }
  @media only screen and (min-width: 640px) {
    .pag-placedetail-reviewskpiicon {
      right: 0.75rem; } }
  @media only screen and (min-width: 640px) {
    .pag-placedetail-reviewskpiicon {
      top: 0.75rem; } }
  .pag-placedetail-reviewskpiicon i {
    margin: 0.6rem 0; }

.pag-placedetail-reviewskpitext {
  margin-right: 2.75rem; }

.pag-placedetail-reviewskpititle {
  font-size: 0.875rem;
  margin-bottom: 0.15rem; }

.pag-placedetail-reviewskpivalue {
  font-weight: bold; }

.pag-placedetail-reviewskpi {
  margin-bottom: 1rem;
  max-width: 20rem; }

.pag-placedetail-reviewsmore {
  margin-top: 1rem; }

.pag-placedetail-section {
  margin-bottom: 4rem; }

.pag-placedetail-sectiontitle {
  margin-bottom: 0.5rem; }

.pag-placedetail-similar {
  scrollbar-width: thin;
  scrollbar-color: #e3e3e3 transparent;
  overflow-x: scroll;
  white-space: nowrap;
  margin: 1rem -0.625rem; }
  .pag-placedetail-similar::-webkit-scrollbar {
    height: 6px; }
  .pag-placedetail-similar::-webkit-scrollbar-thumb {
    background-color: #e3e3e3;
    border-radius: 2px; }
  .pag-placedetail-similar .cmp-tilelist {
    display: inline-block;
    margin: 0 0.625rem 1rem;
    vertical-align: top;
    width: 18rem; }

.pag-placedetail-single {
  margin: 1rem auto;
  max-width: 24rem; }

.pag-placedetail-spaces {
  padding-left: 0.125rem;
  padding-right: 0.125rem; }
  @media only screen and (min-width: 640px) {
    .pag-placedetail-spaces {
      padding-left: 0; } }
  @media only screen and (min-width: 640px) {
    .pag-placedetail-spaces {
      padding-right: 0; } }

.pag-placedetail-stickywrapper {
  display: inline-block;
  margin-right: 1rem;
  vertical-align: middle; }

.pag-placedetail-unpublished {
  margin-bottom: 5rem; }

.pag-placedetail-unpublishedcomment {
  color: #757575;
  font-size: 1rem;
  font-weight: normal; }

.pag-placedetail-unpublishedlink {
  padding: 0.125rem 0.5rem; }

.pag-placedetail-unpublishedicon {
  font-size: 5rem;
  margin-bottom: 0.5rem; }

.pag-placedetail-unpublishedsection {
  margin-bottom: 2.5rem;
  margin-top: 2.5rem; }

.pag-placedetail-unpublishedtext {
  margin-bottom: 0.5rem; }

.pag-placedetail-workspace {
  background-color: rgba(231, 86, 53, 0.1);
  position: relative;
  padding: 0.5rem 0.75rem;
  margin-top: 1.5rem; }
  @media only screen and (min-width: 960px) {
    .pag-placedetail-workspace {
      padding: 1rem 1.5rem; } }

@media only screen and (min-width: 640px) {
  .pag-placedetail-workspacecontent {
    max-width: calc(100% - 13rem); } }

.pag-placedetail-workspaceactions {
  margin-top: 0.5rem; }
  @media only screen and (min-width: 640px) {
    .pag-placedetail-workspaceactions {
      max-width: 13rem; } }
  @media only screen and (min-width: 640px) {
    .pag-placedetail-workspaceactions {
      margin-top: 0; } }
  @media only screen and (min-width: 640px) {
    .pag-placedetail-workspaceactions {
      position: absolute; } }
  @media only screen and (min-width: 640px) {
    .pag-placedetail-workspaceactions {
      right: 1rem; } }
  @media only screen and (min-width: 640px) {
    .pag-placedetail-workspaceactions {
      -ms-transform: translateY(-50%);
          transform: translateY(-50%); } }
  @media only screen and (min-width: 640px) {
    .pag-placedetail-workspaceactions {
      top: 50%; } }

.pag-placedetail-workspacetitle {
  margin-bottom: 0.25rem; }

.pag-placeform .lyt-sided {
  margin: 0.75rem auto 0;
  padding: 0 0.75rem; }
  @media only screen and (min-width: 960px) {
    .pag-placeform .lyt-sided {
      margin: 1.25rem auto 0; } }
  @media only screen and (min-width: 640px) {
    .pag-placeform .lyt-sided {
      max-width: 640px; } }
  @media only screen and (min-width: 960px) {
    .pag-placeform .lyt-sided {
      max-width: 920px; } }
  @media only screen and (min-width: 1280px) {
    .pag-placeform .lyt-sided {
      max-width: 1280px; } }
  @media only screen and (min-width: 1600px) {
    .pag-placeform .lyt-sided {
      max-width: 1280px; } }
  @media only screen and (min-width: 640px) {
    .pag-placeform .lyt-sided {
      padding: 0 20px; } }

@media only screen and (min-width: 960px) {
  .pag-placeform .lyt-sided {
    position: relative; } }

@media only screen and (min-width: 960px) {
  .pag-placeform .lyt-sided:after {
    content: ""; } }

@media only screen and (min-width: 960px) {
  .pag-placeform .lyt-sided:after {
    display: table; } }

@media only screen and (min-width: 960px) {
  .pag-placeform .lyt-sided:after {
    clear: both; } }

.pag-placeform .lyt-sided .lyt-sided-aside {
  width: 100%; }
  @media only screen and (min-width: 960px) {
    .pag-placeform .lyt-sided .lyt-sided-aside {
      float: right; } }
  @media only screen and (min-width: 960px) {
    .pag-placeform .lyt-sided .lyt-sided-aside {
      width: 320px; } }
  .pag-placeform .lyt-sided .lyt-sided-aside + .lyt-sided-main {
    margin-top: 2.5rem; }
    @media only screen and (min-width: 960px) {
      .pag-placeform .lyt-sided .lyt-sided-aside + .lyt-sided-main {
        margin-top: 0; } }

.pag-placeform .lyt-sided .lyt-sided-main {
  width: 100%; }
  @media only screen and (min-width: 960px) {
    .pag-placeform .lyt-sided .lyt-sided-main {
      float: left; } }
  @media only screen and (min-width: 960px) {
    .pag-placeform .lyt-sided .lyt-sided-main {
      width: 520px; } }
  @media only screen and (min-width: 1280px) {
    .pag-placeform .lyt-sided .lyt-sided-main {
      width: 880px; } }
  @media only screen and (min-width: 1600px) {
    .pag-placeform .lyt-sided .lyt-sided-main {
      width: 880px; } }
  .pag-placeform .lyt-sided .lyt-sided-main + .lyt-sided-aside {
    margin-top: 2.5rem; }
    @media only screen and (min-width: 960px) {
      .pag-placeform .lyt-sided .lyt-sided-main + .lyt-sided-aside {
        margin-top: 0; } }
    @media only screen and (min-width: 1280px) {
      .pag-placeform .lyt-sided .lyt-sided-main + .lyt-sided-aside .lyt-sided-aside-fixed {
        position: fixed; } }
    @media only screen and (min-width: 1280px) {
      .pag-placeform .lyt-sided .lyt-sided-main + .lyt-sided-aside .lyt-sided-aside-fixed {
        width: 320px; } }

@media only screen and (min-width: 960px) {
  .pag-placeform .lyt-sided .lyt-sided-aside {
    float: left; } }

@media only screen and (min-width: 960px) {
  .pag-placeform .lyt-sided .lyt-sided-aside {
    margin-right: 20px; } }

@media only screen and (min-width: 960px) {
  .pag-placeform .lyt-sided .lyt-sided-main {
    border-left: 1px solid #e3e3e3; } }

@media only screen and (min-width: 960px) {
  .pag-placeform .lyt-sided .lyt-sided-main {
    padding-left: 40px; } }

@media only screen and (min-width: 1280px) {
  .pag-placeform .lyt-sided .lyt-sided-main {
    width: 640px; } }

.pag-placeform .tabs.withsections {
  margin-bottom: 2rem; }
  @media only screen and (min-width: 960px) {
    .pag-placeform .tabs.withsections {
      margin-bottom: 3rem; } }

.pag-placeform .tabs.language {
  margin-bottom: 1rem; }

.pag-placeform .tabs-panel .cmp-placerowelement {
  border: none;
  margin-bottom: 2rem; }

.pag-placeform .tabs-panel.nopadding {
  padding: 0; }

@media only screen and (min-width: 960px) {
  .pag-placeform .tabs-panel.withexplanations {
    margin-right: 15rem; } }

@media only screen and (min-width: 960px) {
  .pag-placeform .tabs-panel.withexplanations {
    padding-right: 1.25rem; } }

.pag-placeform .tabs-title.language > a {
  padding: 0.75rem 1.5rem; }

.pag-placeform .tabs-title.language.current > a {
  box-shadow: 0 -3px 0 0 #50aaeb inset; }

.pag-placeform .tabs-title.language.empty > a {
  color: #aaa; }

.pag-placeform .dropzone {
  border-radius: 2px;
  border: 3px dashed #ccc;
  cursor: pointer;
  margin-top: 1rem;
  min-height: 12.5rem;
  padding: 0; }
  .pag-placeform .dropzone .button {
    font-size: 62.5%;
    margin-bottom: 0;
    margin-top: 0.5rem;
    padding: 0.45rem 0.875rem !important; }
  .pag-placeform .dropzone .dz-details, .pag-placeform .dropzone .dz-error-message {
    display: none; }
  .pag-placeform .dropzone .dz-error-mark {
    padding-top: 1.75rem;
    text-align: center; }
  @media only screen and (min-width: 640px) {
    .pag-placeform .dropzone .dz-image {
      height: 120px; } }
  @media only screen and (min-width: 640px) {
    .pag-placeform .dropzone .dz-image {
      width: 160px; } }
  .pag-placeform .dropzone .dz-image img {
    height: 100%;
    width: 100%; }
  .pag-placeform .dropzone .dz-message {
    color: #aaa;
    padding: 4.25rem 0;
    margin: 0; }
    .pag-placeform .dropzone .dz-message i {
      font-size: 3rem; }
  .pag-placeform .dropzone .dz-preview .dz-image {
    border-radius: 5px; }
  .pag-placeform .dropzone .dz-preview:nth-child(2) .dz-image {
    border: 5px solid #50aaeb; }
  .pag-placeform .dropzone .dz-preview.dz-complete.dz-image-preview {
    background-color: transparent; }

.pag-placeform-address {
  margin-bottom: 1rem;
  padding-left: 1rem; }

.pag-placeform-addspacebtn {
  margin-top: 2rem; }

.pag-placeform-alert {
  color: #cc4b37;
  font-size: 0.875rem; }

.pag-placeform-autoapproval ul {
  list-style: none;
  margin-left: 0; }

.pag-placeform-cancellation label {
  margin-bottom: 0.25rem; }

.pag-placeform-cancellation textarea {
  height: 3.9rem;
  min-height: 3.9rem; }

.pag-placeform-cancellationcustom {
  margin-bottom: 1.25rem; }

.pag-placeform-channel {
  margin: 0.75rem 0 1.25rem;
  -ms-flex-pack: justify;
      justify-content: space-between; }
  @media only screen and (min-width: 640px) {
    .pag-placeform-channel {
      padding-right: 5rem; } }
  @media only screen and (min-width: 960px) {
    .pag-placeform-channel {
      padding-right: 10rem; } }
  .pag-placeform-channel input:checked ~ .switch-paddle {
    background: rgba(80, 170, 235, 0.6); }
  .pag-placeform-channel input:checked ~ .switch-paddle::after {
    background: #50aaeb; }
  .pag-placeform-channel .cmp-domainvisibilityform-offvisiblity ~ .switch-paddle {
    display: none; }

.pag-placeform-channellabelwrapper i {
  margin-left: 1.5rem; }

.pag-placeform-channellink {
  display: inline-block;
  margin-left: 1rem; }

.pag-placeform-checkboxes label {
  margin-bottom: 0.25rem; }

.pag-placeform-checkboxes .row {
  margin-left: -0.125rem;
  margin-right: -0.125rem; }
  .pag-placeform-checkboxes .row .column, .pag-placeform-checkboxes .row .columns {
    padding: 0.125rem; }

.pag-placeform-dimensionscapacity.row {
  margin-top: -0.45rem; }
  .pag-placeform-dimensionscapacity.row .column, .pag-placeform-dimensionscapacity.row .columns {
    padding-bottom: 0.45rem;
    padding-top: 0.45rem;
    position: relative; }
    .pag-placeform-dimensionscapacity.row .column label, .pag-placeform-dimensionscapacity.row .columns label {
      margin-top: 0.155rem;
      text-align: center;
      width: 5rem; }
    .pag-placeform-dimensionscapacity.row .column img, .pag-placeform-dimensionscapacity.row .columns img {
      height: 1.75rem;
      width: 5rem; }
    .pag-placeform-dimensionscapacity.row .column input, .pag-placeform-dimensionscapacity.row .columns input {
      position: absolute;
      left: 5.5rem;
      top: 0.5rem;
      width: calc(100% - 6rem); }

.pag-placeform-dimensionstext {
  color: #757575;
  font-size: 0.875rem;
  margin: 0.5rem 0; }

.pag-placeform-edit {
  margin-top: 0.5rem; }

.pag-placeform-errors {
  color: #cc4b37;
  margin-bottom: 2rem; }

.pag-placeform-explanation {
  display: none;
  background-color: #f1f8fd;
  margin-bottom: 0.5rem;
  padding: 0.75rem 1rem 1rem; }
  @media only screen and (min-width: 640px) {
    .pag-placeform-explanation {
      display: block; } }
  @media only screen and (min-width: 1280px) {
    .pag-placeform-explanation {
      position: absolute; } }
  @media only screen and (min-width: 1280px) {
    .pag-placeform-explanation {
      right: -16.25rem; } }
  @media only screen and (min-width: 1280px) {
    .pag-placeform-explanation {
      top: 0; } }
  @media only screen and (min-width: 1280px) {
    .pag-placeform-explanation {
      width: 15rem; } }

.pag-placeform-explanationicon {
  color: #50aaeb;
  font-size: 1.75rem;
  position: relative;
  top: 0.1rem;
  -ms-transform: rotate(180deg);
      transform: rotate(180deg); }

.pag-placeform-explanationtext {
  padding-top: 0.25rem; }

.pag-placeform-extrascategory > .row {
  margin-left: -0.25rem;
  margin-right: -0.25rem; }
  .pag-placeform-extrascategory > .row > .column, .pag-placeform-extrascategory > .row > .columns {
    padding: 0.25rem; }

.pag-placeform-extrascategory + .pag-placeform-extrascategory {
  margin-top: 1rem; }

.pag-placeform-extrastitle {
  margin-bottom: 0.25rem; }

.pag-placeform-guide {
  padding: 0 0.625rem;
  position: relative; }
  @media only screen and (min-width: 640px) {
    .pag-placeform-guide {
      padding: 0; } }

.pag-placeform-guideexplanation {
  margin-bottom: 0.75rem; }

.pag-placeform-guideicon {
  position: absolute;
  right: 0;
  top: 0;
  width: 3rem; }

.pag-placeform-guidestep {
  position: relative; }
  .pag-placeform-guidestep.inner {
    counter-increment: innerstep;
    margin-top: 1rem; }
  .pag-placeform-guidestep.outer {
    counter-increment: outerstep;
    margin-top: 2rem; }
  .pag-placeform-guidestep.short {
    counter-increment: shortstep;
    margin-top: 0.5rem; }
  .pag-placeform-guidestep.checked .pag-placeform-guidestepnumber {
    background-color: #50aaeb;
    border-color: #50aaeb;
    color: #50aaeb; }
    .pag-placeform-guidestep.checked .pag-placeform-guidestepnumber::after {
      content: "done";
      font-family: 'Material Icons';
      left: 0;
      position: absolute;
      right: 0;
      top: 50%;
      -ms-transform: translateY(-50%);
          transform: translateY(-50%); }
    .pag-placeform-guidestep.checked .pag-placeform-guidestepnumber::after {
      color: white; }
  .pag-placeform-guidestep.checked .pag-placeform-guidesteptitle {
    color: #50aaeb;
    font-weight: bold; }

.pag-placeform-guidestepactions {
  margin-left: 2.75rem;
  margin-top: 0.5rem; }
  .pag-placeform-guidestepactions form {
    display: inline-block; }

.pag-placeform-guidestepcontent {
  margin-left: 2.25rem; }

.pag-placeform-guidestepnumber.inner {
  border: 1px solid #757575;
  border-radius: 50%;
  box-sizing: content-box;
  color: #757575;
  font-size: 1rem;
  height: 1.5rem;
  position: relative;
  text-align: center;
  width: 1.5rem;
  position: absolute;
  top: 0.25rem; }
  .pag-placeform-guidestepnumber.inner::after {
    content: counter(innerstep); }

.pag-placeform-guidestepnumber.outer {
  border: 1px solid #757575;
  border-radius: 50%;
  box-sizing: content-box;
  color: #757575;
  font-size: 1rem;
  height: 1.5rem;
  position: relative;
  text-align: center;
  width: 1.5rem;
  position: absolute;
  top: 0.25rem; }
  .pag-placeform-guidestepnumber.outer::after {
    content: counter(outerstep); }

.pag-placeform-guidestepnumber.short {
  border: 1px solid #757575;
  border-radius: 50%;
  box-sizing: content-box;
  color: #757575;
  font-size: 0.875rem;
  height: 1rem;
  position: relative;
  text-align: center;
  width: 1rem;
  left: 0.5rem;
  position: absolute;
  top: 0; }
  .pag-placeform-guidestepnumber.short::after {
    content: counter(shortstep); }

.pag-placeform-guidesteptitle {
  margin-left: 2.25rem;
  padding: 0.125rem 0; }

.pag-placeform-guidetitle {
  border-bottom: 3px solid #e3e3e3;
  margin-bottom: 1.5rem;
  padding-bottom: 1rem;
  padding-right: 3rem;
  padding-top: 0.4rem; }

.pag-placeform-help {
  background-color: #f1f8fd;
  margin-bottom: 1.5rem;
  position: relative;
  padding: 1.5rem 2.5rem 1.5rem 6.5rem; }
  @media only screen and (min-width: 1280px) {
    .pag-placeform-help {
      margin-bottom: 2.5rem; } }

.pag-placeform-helpclose {
  position: absolute;
  right: 1rem;
  top: 1rem; }

.pag-placeform-helpcomment {
  margin-bottom: 0.5rem; }

.pag-placeform-helpimage {
  background-size: 100%;
  padding-bottom: 62.5%;
  margin-bottom: 0.5rem;
  width: 100%; }

.pag-placeform-helpsvg {
  background-repeat: no-repeat;
  height: 6rem;
  left: 1.5rem;
  position: absolute;
  width: 4rem; }

.pag-placeform-helptitle {
  margin-bottom: 0.5rem; }

.pag-placeform-label {
  color: #757575;
  font-size: 0.875rem; }

.pag-placeform-map {
  min-height: 20rem;
  margin-top: 1rem;
  width: 100%; }

.pag-placeform-orgsadd {
  cursor: pointer; }

.pag-placeform-orgscomment {
  color: #757575;
  font-size: 0.875rem; }

.pag-placeform-orgslabel {
  display: inline-block;
  margin-right: 0.5rem; }

.pag-placeform-orgslist {
  margin-left: 0.75rem; }

.pag-placeform-orgslistadd {
  cursor: pointer; }
  .pag-placeform-orgslistadd:hover {
    opacity: 0.75; }

.pag-placeform-orgslogo {
  background-position: center center;
  background-repeat: no-repeat;
  background-size: cover;
  border-radius: 50%;
  display: inline-block;
  height: 2rem;
  margin-right: 0.5rem;
  position: relative;
  top: 0.6rem;
  width: 2rem; }

.pag-placeform-orgsname {
  text-transform: uppercase; }

.pag-placeform-orgsselect {
  padding-bottom: 0.5rem !important;
  padding-top: 0.5rem !important;
  width: auto; }

.pag-placeform-orgstag {
  background-color: #fefefe;
  border-radius: 2px;
  border: 1px solid #50aaeb;
  color: #50aaeb;
  display: inline-block;
  font-size: 0.875rem;
  padding: 0.2rem 0.4rem 0.1rem;
  margin: 0 0.5rem 0 0;
  text-transform: uppercase; }

.pag-placeform-packagebutton {
  margin-top: 1.5rem; }

.pag-placeform-pricingbutton {
  display: block;
  margin-top: 1rem; }

.pag-placeform-pricinggrid.row {
  margin-bottom: 0.5rem;
  margin-left: 0.75rem; }
  .pag-placeform-pricinggrid.row .column, .pag-placeform-pricinggrid.row .columns {
    padding-bottom: 0.375rem;
    padding-top: 0.375rem; }

.pag-placeform-pricinggrid .short .column:nth-child(2), .pag-placeform-pricinggrid .short .columns:nth-child(2) {
  display: none; }

.pag-placeform-pricinggrid .short .column:nth-child(3), .pag-placeform-pricinggrid .short .columns:nth-child(3) {
  display: none; }

.pag-placeform-pricingtext {
  color: #757575;
  font-size: 0.875rem;
  margin-bottom: 0.5rem; }

.pag-placeform-promo {
  background-color: #50aaeb;
  background-repeat: no-repeat;
  background-position: center center;
  background-attachment: scroll;
  background-size: cover;
  color: #fefefe;
  margin: 0.25rem 0 0.5rem;
  padding: 0.5rem 2rem; }
  .pag-placeform-promo a {
    color: #fefefe;
    text-decoration: underline; }

.pag-placeform-promobutton {
  display: block;
  margin-top: 0.25rem; }

.pag-placeform-promotext {
  margin-top: 0.25rem; }

.pag-placeform-promotitle {
  font-weight: bold; }

.pag-placeform-rulessection {
  margin-bottom: 0.5rem; }

.pag-placeform-success {
  margin: 2.5rem 0;
  text-align: center; }

.pag-placeform-successicon {
  font-size: 5rem;
  margin-bottom: 1.5rem; }

.pag-placeform-successtitle {
  margin-bottom: 1rem;
  text-transform: uppercase; }

.pag-placeform-section {
  margin-bottom: 2.5rem;
  position: relative; }
  @media only screen and (min-width: 960px) {
    .pag-placeform-section {
      margin-bottom: 4rem; } }
  .pag-placeform-section > .row:first-child {
    margin-top: -0.25rem; }
    @media only screen and (min-width: 640px) {
      .pag-placeform-section > .row:first-child {
        margin-top: -0.5rem; } }
  .pag-placeform-section > .row:last-child {
    margin-bottom: -0.25rem; }
    @media only screen and (min-width: 640px) {
      .pag-placeform-section > .row:last-child {
        margin-bottom: -0.5rem; } }
  .pag-placeform-section > .row > .column, .pag-placeform-section > .row > .columns {
    padding-bottom: 0.25rem;
    padding-top: 0.25rem; }
    @media only screen and (min-width: 640px) {
      .pag-placeform-section > .row > .column, .pag-placeform-section > .row > .columns {
        padding-bottom: 0.5rem; } }
    @media only screen and (min-width: 640px) {
      .pag-placeform-section > .row > .column, .pag-placeform-section > .row > .columns {
        padding-top: 0.5rem; } }

.pag-placeform-sectioncomment {
  color: #757575;
  font-size: 0.875rem;
  margin-bottom: 1rem; }
  .pag-placeform-sectioncomment a {
    font-size: 0.875rem; }

.pag-placeform-sectionintro {
  margin-bottom: 1rem; }

.pag-placeform-sectionsub + .pag-placeform-sectionsub {
  margin-top: 1rem; }

.pag-placeform-suitabilityambience {
  position: relative; }

.pag-placeform-suitabilityambiencebar {
  background-color: #e3e3e3;
  margin-bottom: 0.5rem;
  margin-left: 3.5rem;
  height: 0.4rem;
  position: relative; }

.pag-placeform-suitabilityambiencefill {
  background-color: #50aaeb;
  height: 0.4rem;
  position: absolute; }

.pag-placeform-suitabilityambienceimage {
  height: 2.5rem;
  margin-left: 0.25rem;
  position: absolute;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%);
  width: 2.5rem; }

.pag-placeform-suitabilityambiencetext {
  color: #757575;
  font-size: 0.875rem;
  margin: 0.5rem 0 0.4rem 3.5rem; }

.pag-placeform-suitabilityintro {
  margin-top: 1rem; }

.pag-placeform-suitabilitysituation {
  text-align: center; }

.pag-placeform-suitabilitysituationimage {
  height: 2.5rem;
  width: 2.5rem; }

.pag-placeform-suitabilitysituationtext {
  color: #757575;
  font-size: 0.875rem;
  margin-top: 0.2rem; }
  .pag-placeform-suitabilitysituationtext::first-letter {
    text-transform: uppercase; }

.pag-placeform-textareasmall textarea {
  height: 5.3rem;
  min-height: 5.3rem; }

.pag-placeform-note {
  font-size: 0.875rem;
  margin-bottom: 0.5rem;
  margin-top: 0.5rem; }

.pag-placeform-warnicon {
  font-size: 7.5rem;
  margin-bottom: 1.5rem; }

.pag-placeform-warnwrapper {
  padding: 2rem; }

.pag-placeform-title {
  margin-bottom: 0.5rem; }

@media only screen and (min-width: 1280px) {
  .pag-placelist {
    overflow-y: hidden; } }

.pag-placelist .cmp-customers {
  padding: 1.5rem 1rem; }

@media only screen and (min-width: 960px) {
  .pag-placelist .cmp-inputiconed-icon {
    display: none; } }

@media only screen and (min-width: 1600px) {
  .pag-placelist .cmp-inputiconed-icon {
    display: block; } }

.pag-placelist .sb-place-carousel.slick-slider {
  margin-bottom: 0;
  position: absolute; }

.pag-placelist .sb-place-carousel .slick-list {
  height: 100%; }

.pag-placelist .sb-place-carousel .slick-track {
  height: 100%;
  width: auto; }

.pag-placelist .sb-place-carousel .slick-slide {
  background-color: #333;
  height: 100%;
  overflow: hidden;
  text-align: center;
  width: auto; }
  .pag-placelist .sb-place-carousel .slick-slide img {
    height: 100%;
    margin: 0 auto; }

.pag-placelist .sb-place-carousel .slick-prev {
  text-shadow: 1px 0px #757575; }
  .pag-placelist .sb-place-carousel .slick-prev:before {
    color: #fefefe; }

.pag-placelist .sb-place-carousel .slick-next {
  text-shadow: -1px 0px #757575; }
  .pag-placelist .sb-place-carousel .slick-next:before {
    color: #fefefe; }

.pag-placelist .sb-search-carousel:not(.slick-slider) {
  display: none; }

.pag-placelist .sb-search-carousel .slick-slide {
  padding: 1rem 0.875rem; }

.pag-placelist .sb-search-carousel .slick-next, .pag-placelist .sb-search-carousel .slick-prev {
  background-color: #fefefe;
  border-radius: 50%; }
  .pag-placelist .sb-search-carousel .slick-next:before, .pag-placelist .sb-search-carousel .slick-prev:before {
    color: #333;
    font-size: 2.75rem; }

.pag-placelist .sb-search-carousel .slick-next:before {
  padding-left: 0.25rem; }

.pag-placelist .sb-search-carousel .slick-prev:before {
  padding-right: 0.25rem; }

.pag-placelist .leaflet-marker-icon {
  margin-left: 0 !important;
  margin-top: 0 !important;
  width: auto !important;
  height: auto !important; }

.pag-placelist-banner {
  height: 5.5rem;
  margin: 0.875rem;
  padding: 0.5rem 0.875rem;
  position: relative; }
  .pag-placelist-banner.hireset {
    background-color: #aaa;
    background-repeat: no-repeat;
    background-position: center center;
    background-attachment: fixed;
    background-size: cover; }
  .pag-placelist-banner.recon {
    background-color: #50aaeb;
    color: #fefefe; }

.pag-placelist-bannercart {
  color: #fefefe;
  font-size: 3rem; }

@keyframes bounce {
  0% {
    transform: scale(1);
    opacity: 1; }
  40% {
    transform: scale(0.2);
    opacity: .7; }
  60% {
    transform: scale(0.9);
    opacity: 1; }
  80% {
    transform: scale(1.05); }
  100% {
    transform: scale(1); } }
  .pag-placelist-bannercart.bounce {
    animation-name: bounce;
    animation-duration: 1s; }

.pag-placelist-bannercontent {
  margin-right: 4rem; }

.pag-placelist-bannergrid.row {
  margin-left: 0;
  margin-right: 0; }
  .pag-placelist-bannergrid.row .column, .pag-placelist-bannergrid.row .columns {
    padding: 0; }

.pag-placelist-bannershopping {
  right: 1.25rem;
  position: absolute;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%); }

.pag-placelist-bannertext {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap; }

.pag-placelist-bannertitle {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap;
  font-weight: bold;
  margin-bottom: 0.25rem;
  margin-right: 0.5rem;
  text-transform: uppercase; }

@media only screen and (min-width: 1280px) {
  .pag-placelist-content.banner .pag-placelist-contentaside, .pag-placelist-content.banner .pag-placelist-contentmain {
    top: 11rem; } }

@media only screen and (min-width: 1280px) {
  .pag-placelist-contentaside, .pag-placelist-contentmain {
    bottom: 0; } }

@media only screen and (min-width: 1280px) {
  .pag-placelist-contentaside, .pag-placelist-contentmain {
    top: 4.625rem; } }

@media only screen and (min-width: 1280px) {
  .pag-placelist-contentaside {
    right: 0; } }

@media only screen and (min-width: 1280px) {
  .pag-placelist-contentaside {
    padding: 0 0.875rem 0.875rem; } }

@media only screen and (min-width: 1280px) {
  .pag-placelist-contentaside {
    position: absolute; } }

@media only screen and (min-width: 1280px) {
  .pag-placelist-contentaside {
    width: calc(100% - 50rem); } }

@media only screen and (min-width: 1600px) {
  .pag-placelist-contentaside {
    width: calc(100% - 74.25rem); } }

.pag-placelist-contentaside.fullscreen {
  background-color: white;
  bottom: 0;
  left: 0;
  position: fixed;
  padding: 3rem 1rem 1rem;
  right: 0;
  top: 0;
  z-index: 700; }
  @media only screen and (min-width: 1280px) {
    .pag-placelist-contentaside.fullscreen {
      left: auto; } }
  @media only screen and (min-width: 1280px) {
    .pag-placelist-contentaside.fullscreen {
      padding: 0; } }
  @media only screen and (min-width: 1280px) {
    .pag-placelist-contentaside.fullscreen {
      z-index: auto; } }

.pag-placelist-contentasideclose {
  position: absolute;
  right: 0;
  top: -0.25rem; }
  .pag-placelist-contentasideclose.button {
    font-size: 1.375rem; }

.pag-placelist-contentmain {
  padding: 0 0.875rem 0.875rem; }
  @media only screen and (min-width: 1280px) {
    .pag-placelist-contentmain {
      left: 0; } }
  @media only screen and (min-width: 1280px) {
    .pag-placelist-contentmain {
      overflow-y: scroll; } }
  @media only screen and (min-width: 1280px) {
    .pag-placelist-contentmain {
      position: absolute; } }
  @media only screen and (min-width: 1280px) {
    .pag-placelist-contentmain {
      width: 50rem; } }
  @media only screen and (min-width: 1600px) {
    .pag-placelist-contentmain {
      width: 74.25rem; } }

.pag-placelist-contentdata {
  padding-left: 0.125rem;
  padding-right: 0.125rem; }
  @media only screen and (min-width: 640px) {
    .pag-placelist-contentdata {
      padding-left: 0; } }
  @media only screen and (min-width: 640px) {
    .pag-placelist-contentdata {
      padding-right: 0; } }
  .pag-placelist-contentdata.overlayed {
    opacity: 0.2;
    position: relative; }
  .pag-placelist-contentdata.overlayed .pag-placelist-contentdataoverlay {
    bottom: 0;
    cursor: default;
    left: 0;
    position: absolute;
    right: 0;
    top: 0;
    z-index: 700; }

.pag-placelist-fetch {
  margin: 4rem 0;
  text-align: center; }

.pag-placelist-filtersboolean {
  max-width: 32rem; }

.pag-placelist-filtersgroup {
  margin-right: 0.875rem;
  margin-top: 0.5rem;
  padding: 1rem 1.5rem;
  position: absolute;
  z-index: 700; }

.pag-placelist-filterslabel {
  margin-bottom: 0.5rem; }

.pag-placelist-filterslink {
  display: inline-block;
  padding: 0.4rem 0.6rem; }

.pag-placelist-filterslist ul {
  list-style: none;
  margin-left: 0; }

.pag-placelist-filtersselect {
  max-width: 24rem; }

.pag-placelist-filtersslider {
  padding-bottom: 1.5rem;
  width: 18rem; }

.pag-placelist-filterstogglebuttons {
  margin-top: 0.75rem;
  margin-bottom: 1.5rem; }

.pag-placelist-filterstogglebuttonswrapper {
  margin-top: 1.5rem;
  margin-bottom: 0.5rem; }
  .pag-placelist-filterstogglebuttonswrapper input[type=radio].cmp-radioselectbar + label {
    padding-left: 0;
    padding-right: 0; }
    @media only screen and (min-width: 640px) {
      .pag-placelist-filterstogglebuttonswrapper input[type=radio].cmp-radioselectbar + label {
        padding-left: 0.25rem; } }
    @media only screen and (min-width: 640px) {
      .pag-placelist-filterstogglebuttonswrapper input[type=radio].cmp-radioselectbar + label {
        padding-right: 0.25rem; } }

.pag-placelist-filterstogglebutton {
  border: 1px solid #e3e3e3;
  border-radius: 1rem;
  display: inline-block;
  font-size: 0.875rem;
  padding: 0.2rem 0.5rem;
  text-decoration: none;
  display: -ms-flexbox;
  display: flex;
  -ms-flex-align: center;
      align-items: center;
  color: #aaa;
  border-color: #aaa;
  box-shadow: none;
  font-size: 1rem; }
  .pag-placelist-filterstogglebutton:hover {
    background-color: #e3e3e3; }
  .pag-placelist-filterstogglebutton.hollow {
    background-color: transparent;
    border: 1px solid #ddd; }
  .pag-placelist-filterstogglebutton.interactable {
    cursor: pointer; }
  .pag-placelist-filterstogglebutton.active {
    color: #333;
    border-color: #333; }
  .pag-placelist-filterstogglebutton i {
    margin: 0; }
    .pag-placelist-filterstogglebutton i.left {
      font-size: 1.25rem; }

.pag-placelist-filterstogglevalue {
  margin-left: 0.25rem; }
  .pag-placelist-filterstogglevalue:not(:empty)::after {
    content: ')'; }
  .pag-placelist-filterstogglevalue:not(:empty)::before {
    content: '('; }

.pag-placelist-filterstypes input[type=checkbox] + label {
  overflow: hidden;
  text-overflow: ellipsis;
  white-space: nowrap;
  display: block; }

.pag-placelist-filterstypes .row {
  margin-bottom: -0.25rem;
  margin-top: -0.25rem; }
  .pag-placelist-filterstypes .row .column, .pag-placelist-filterstypes .row .columns {
    padding: 0.25rem 0.875rem !important;
    position: relative; }

.pag-placelist-filterswrapper {
  margin-top: 0.75rem; }

.pag-placelist-map {
  height: 100%;
  overflow: hidden;
  width: 100%; }

.pag-placelist-maptoggle {
  bottom: 1rem;
  left: 50%;
  position: fixed;
  -ms-transform: translateX(-50%);
      transform: translateX(-50%);
  z-index: 200; }

.pag-placelist-mapvalues {
  background-color: #fefefe;
  left: 0;
  margin: 0 1.5rem;
  padding: 0.25rem 0.5rem;
  position: absolute;
  top: 0.5rem;
  z-index: 320; }
  .pag-placelist-mapvalues p {
    display: inline-block; }

.pag-placelist-request {
  position: relative; }

.pag-placelist-requestaction {
  margin-top: 0.25rem; }
  @media only screen and (min-width: 640px) {
    .pag-placelist-requestaction {
      margin-top: 0.5rem; } }

@media only screen and (min-width: 960px) {
  .pag-placelist-requestcontent {
    margin-right: 3.5rem; } }

.pag-placelist-requestimage {
  display: none;
  position: absolute;
  right: 0;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%);
  width: 3rem; }
  @media only screen and (min-width: 960px) {
    .pag-placelist-requestimage {
      display: block; } }

.pag-placelist-requesttext {
  margin-bottom: 0.25rem; }

.pag-placelist-requesttitle {
  margin-bottom: 0.25rem; }

@media only screen and (min-width: 960px) {
  .pag-placelist-request {
    padding: 0 0.5rem; } }

.pag-placelist-requestswitch {
  display: inline-block;
  margin-right: 2rem; }

.pag-placelist-requestswitchlabel {
  display: inline-block;
  margin-left: 0.5rem; }

.pag-placelist-sections {
  text-align: center;
  text-transform: uppercase; }
  @media only screen and (min-width: 960px) {
    .pag-placelist-sections {
      max-width: 20rem; } }
  .pag-placelist-sections .row {
    margin-left: 0;
    margin-right: 0; }
    .pag-placelist-sections .row .column, .pag-placelist-sections .row .columns {
      padding: 0 0 0.75rem; }
      @media only screen and (min-width: 960px) {
        .pag-placelist-sections .row .column, .pag-placelist-sections .row .columns {
          padding: 0.4rem 0; } }
      .pag-placelist-sections .row .column.inactive, .pag-placelist-sections .row .inactive.columns {
        border-bottom: 3px solid #ddd; }
        .pag-placelist-sections .row .column.inactive a, .pag-placelist-sections .row .inactive.columns a {
          color: #757575; }
      .pag-placelist-sections .row .column.active, .pag-placelist-sections .row .active.columns {
        border-bottom: 3px solid #e75635; }

.pag-placelist-seoheadercontent {
  margin-bottom: 1rem;
  margin-top: 0.25rem; }

.pag-placelist-seoside {
  padding-top: 1rem; }
  @media only screen and (min-width: 1280px) {
    .pag-placelist-seoside {
      padding-top: 0; } }

.pag-placelist-seosideheader {
  margin-bottom: 1rem; }

.pag-placelist-seosideimage {
  background-repeat: no-repeat;
  background-position: center;
  background-size: cover;
  width: 100%;
  padding: 5rem 0;
  text-align: center; }

.pag-placelist-seosidesubtitle {
  font-weight: normal;
  margin-bottom: 0.5rem; }

.pag-placelist-seosidetitle {
  font-weight: normal;
  margin: 0.5rem 0; }

.pag-placelist-seosubtitle {
  margin: 0.25rem 0 0; }

.pag-placelist-title {
  margin-top: 0.75rem; }
  @media only screen and (min-width: 640px) {
    .pag-placelist-title {
      margin-top: 0.25rem; } }

.pag-pickuser .errorlist {
  margin-bottom: 1rem; }

.pag-pickuser-button {
  margin-top: 1rem; }

.pag-pickuser-card {
  margin-top: 2.5rem;
  padding: 2rem 3rem; }

.pag-pickuser-comment {
  margin-bottom: 1.5rem; }

.pag-pickuser-form input {
  margin-bottom: 0.875rem; }

.pag-pickuser-title {
  font-weight: bold;
  text-transform: uppercase; }

.pag-profileform .tabs-panel {
  padding-bottom: 2rem;
  padding-top: 2rem; }
  @media only screen and (min-width: 960px) {
    .pag-profileform .tabs-panel {
      padding-bottom: 4rem; } }
  @media only screen and (min-width: 960px) {
    .pag-profileform .tabs-panel {
      padding-top: 4rem; } }

.pag-profileform-buttons {
  margin: 1rem auto 0 auto;
  text-align: center; }

.pag-profileform-label {
  padding-bottom: 0.5rem; }

.pag-profileform-socialgrid {
  gap: 0.75rem;
  max-width: 15rem; }

.pag-profileform-title {
  margin-bottom: 0.5rem; }

.pag-recondetail .cmp-assistantsection {
  margin: 2rem auto;
  max-width: 32rem; }
  @media only screen and (min-width: 640px) {
    .pag-recondetail .cmp-assistantsection {
      margin: 4rem auto; } }

.pag-recondetail .cmp-conversation-actionmessage label {
  display: none; }

.pag-recondetail .cmp-filtercontrols-anchor {
  margin-left: 0.5rem; }

.pag-recondetail .cmp-tilerecon-value.space {
  display: none; }

.pag-recondetail .nvd3 .domain {
  stroke: #757575 !important;
  stroke-opacity: .75 !important; }

.pag-recondetail .nvd3 .nv-axis line {
  opacity: 0 !important; }

.pag-recondetail .slick-slider {
  margin-bottom: 0;
  position: absolute; }

.pag-recondetail .slick-list {
  height: 100%; }

.pag-recondetail .slick-track {
  height: 100%;
  width: auto; }

.pag-recondetail .slick-slide {
  background-color: #333;
  height: 100%;
  overflow: hidden;
  text-align: center;
  width: auto; }
  .pag-recondetail .slick-slide img {
    height: 100%;
    margin: 0 auto; }

.pag-recondetail .slick-prev {
  text-shadow: 1px 0px #757575; }
  .pag-recondetail .slick-prev:before {
    color: #fefefe; }

.pag-recondetail .slick-next {
  text-shadow: -1px 0px #757575; }
  .pag-recondetail .slick-next:before {
    color: #fefefe; }

.pag-recondetail-action form {
  display: inline-block; }

.pag-recondetail-action span {
  display: inline-block; }

.pag-recondetail-action .button {
  position: relative;
  top: -0.075rem; }

.pag-recondetail-modalcontent {
  height: 20rem;
  width: 100%; }
  @media only screen and (min-width: 640px) {
    .pag-recondetail-modalcontent {
      height: 40rem; } }
  .pag-recondetail-modalcontent svg {
    display: block;
    height: 100%;
    width: 100%; }
  .pag-recondetail-modalcontent text {
    font-size: 12px;
    font-family: Lato, Helvetica, Arial, sans-serif; }

.pag-recondetail-conversation {
  margin-bottom: 1rem;
  position: relative; }

.pag-recondetail-conversationtext {
  margin-top: 0.5rem; }

.pag-recondetail-conversationphoto {
  background-position: center center;
  background-size: cover;
  border-radius: 50%;
  display: block;
  position: absolute;
  height: 2.25rem;
  width: 2.25rem; }

@media only screen and (min-width: 1280px) {
  .pag-recondetail-equalizercontainer {
    display: inline-block; } }

.pag-recondetail-intro {
  margin-bottom: 2rem;
  margin-top: 1rem; }

.pag-recondetail-introcomment {
  margin-top: 0.5rem;
  text-align: center; }

.pag-recondetail-items {
  scrollbar-width: thin;
  scrollbar-color: #e3e3e3 transparent;
  overflow-x: scroll;
  white-space: nowrap;
  margin: 1rem -0.625rem; }
  .pag-recondetail-items::-webkit-scrollbar {
    height: 6px; }
  .pag-recondetail-items::-webkit-scrollbar-thumb {
    background-color: #e3e3e3;
    border-radius: 2px; }

.pag-recondetail-next {
  margin: 4rem 0 8rem;
  text-align: center; }

.pag-recondetail-nextmain {
  margin: 1rem 0 0.5rem; }

.pag-recondetail-panel {
  padding: 1.5rem;
  position: relative;
  margin-bottom: 2rem; }

.pag-recondetail-panelaction {
  position: absolute;
  right: 1.5rem;
  top: 1.5rem; }

.pag-recondetail-panelcomment {
  margin-bottom: 0.5rem; }

.pag-recondetail-paneltitle {
  margin-bottom: 0.5rem; }

.pag-recondetail-particles {
  background-color: #f7f7f7;
  background-repeat: no-repeat;
  background-position: center center;
  background-attachment: fixed;
  background-size: cover;
  bottom: 0;
  height: 100%;
  left: 0;
  position: fixed;
  right: 0;
  top: 0;
  width: 100%;
  z-index: 700; }

.pag-recondetail-particlescontent {
  margin: 1rem;
  left: 0;
  position: absolute;
  right: 0;
  text-align: center;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%); }
  @media only screen and (min-width: 960px) {
    .pag-recondetail-particlescontent {
      margin: 0 auto; } }
  @media only screen and (min-width: 960px) {
    .pag-recondetail-particlescontent {
      max-width: 50rem; } }

.pag-recondetail-particlesloading {
  backface-visibility: hidden;
  background-color: transparent;
  height: 0.125rem;
  overflow: hidden;
  position: absolute;
  top: 0;
  width: 100%; }

@keyframes loading {
  from {
    left: -200px;
    width: 30%; }
  50% {
    width: 30%; }
  70% {
    width: 70%; }
  80% {
    left: 50%; }
  95% {
    left: 120%; }
  to {
    left: 100%; } }
  .pag-recondetail-particlesloading:before {
    animation: loading 2s linear infinite;
    background-color: #e75635;
    content: "";
    display: block;
    height: 4px;
    left: -200px;
    position: absolute;
    width: 200px; }

.pag-recondetail-particlestexts {
  padding: 2rem; }

.pag-recondetail-proposals {
  max-width: 21.5rem; }
  @media only screen and (min-width: 640px) {
    .pag-recondetail-proposals {
      max-width: 44.25rem; } }
  @media only screen and (min-width: 960px) {
    .pag-recondetail-proposals {
      max-width: 55rem; } }
  @media only screen and (min-width: 1280px) {
    .pag-recondetail-proposals {
      max-width: 70rem; } }
  @media only screen and (min-width: 1280px) {
    .pag-recondetail-proposals {
      margin-bottom: 2rem; } }

@media only screen and (min-width: 1280px) {
  .pag-recondetail-proposals.list .cmp-tilerecon {
    width: 20rem; }
    .pag-recondetail-proposals.list .cmp-tilerecon.legend {
      padding-left: 2rem;
      width: 16rem; }
      .pag-recondetail-proposals.list .cmp-tilerecon.legend .cmp-tilerecon-actionslabel {
        font-weight: bold;
        padding-top: 0.55rem; }
      .pag-recondetail-proposals.list .cmp-tilerecon.legend .cmp-tilerecon-book {
        border-bottom-color: transparent; }
        .pag-recondetail-proposals.list .cmp-tilerecon.legend .cmp-tilerecon-book .button {
          padding-left: 0 !important;
          padding-right: 0 !important;
          width: 0 !important; }
      .pag-recondetail-proposals.list .cmp-tilerecon.legend .cmp-tilerecon-bookstatus {
        font-weight: bold; }
      .pag-recondetail-proposals.list .cmp-tilerecon.legend .cmp-tilerecon-tag {
        background-color: transparent; }
      .pag-recondetail-proposals.list .cmp-tilerecon.legend .cmp-tilerecon-value {
        border-bottom-color: transparent;
        font-weight: bold; }
        .pag-recondetail-proposals.list .cmp-tilerecon.legend .cmp-tilerecon-value.breakdown {
          text-align: left; }
    .pag-recondetail-proposals.list .cmp-tilerecon .cmp-tilerecon-actions, .pag-recondetail-proposals.list .cmp-tilerecon .cmp-tilerecon-book, .pag-recondetail-proposals.list .cmp-tilerecon .cmp-tilerecon-value {
      padding: 0.75rem 1rem; }
    .pag-recondetail-proposals.list .cmp-tilerecon .cmp-tilerecon-arrow.left {
      left: 1rem; }
    .pag-recondetail-proposals.list .cmp-tilerecon .cmp-tilerecon-arrow.right {
      right: 1rem; }
    .pag-recondetail-proposals.list .cmp-tilerecon .cmp-tilerecon-book {
      padding-top: 0; }
      .pag-recondetail-proposals.list .cmp-tilerecon .cmp-tilerecon-book .button {
        right: 1rem; }
    .pag-recondetail-proposals.list .cmp-tilerecon .cmp-tilerecon-card {
      box-shadow: none; }
    .pag-recondetail-proposals.list .cmp-tilerecon .cmp-tilerecon-carousel {
      left: 1rem;
      right: 1rem; }
    .pag-recondetail-proposals.list .cmp-tilerecon .cmp-tilerecon-info {
      padding-right: 0;
      padding-left: 0; }
    .pag-recondetail-proposals.list .cmp-tilerecon .cmp-tilerecon-intro {
      padding-top: 0; }
    .pag-recondetail-proposals.list .cmp-tilerecon .cmp-tilerecon-label {
      font-size: 0.875rem;
      text-transform: uppercase; }
    .pag-recondetail-proposals.list .cmp-tilerecon .cmp-tilerecon-value.breakdown .cmp-tilerecon-valuelabel {
      left: 1rem; }
    .pag-recondetail-proposals.list .cmp-tilerecon .cmp-tilerecon-value.long {
      height: 5.5rem; }
    .pag-recondetail-proposals.list .cmp-tilerecon .cmp-tilerecon-value.space {
      display: block; } }

.pag-recondetail-proposalsgrid.sortable .cmp-tilebooking {
  cursor: move; }

.pag-recondetail-success {
  background-color: green;
  border-radius: 50%;
  color: #fefefe;
  font-size: 2rem;
  height: 3rem;
  margin-top: 0.5rem;
  padding: 0.5rem;
  text-align: center;
  width: 3rem; }

.pag-recondetail-tileitem {
  display: inline-block;
  margin: 0 0.625rem 1rem;
  vertical-align: top;
  width: 20rem; }

.pag-recondetail-title {
  margin-bottom: 0.5rem;
  text-align: center; }

.pag-reconform .cmp-fileinputs {
  margin-bottom: 1rem; }

.pag-reconform-addnotecontainer {
  margin: 0.5rem 0 1rem; }

.pag-reconform-ambience {
  margin-bottom: 0.75rem; }
  .pag-reconform-ambience input[type=checkbox] + label {
    height: 100%;
    width: 100%; }
    .pag-reconform-ambience input[type=checkbox] + label:before {
      background-clip: content-box;
      background-position: center;
      background-repeat: no-repeat;
      background-size: cover;
      border: none;
      border-radius: 0;
      height: 100%;
      top: 0;
      width: 100%; }
    .pag-reconform-ambience input[type=checkbox] + label:after {
      display: none; }
    .pag-reconform-ambience input[type=checkbox] + label span {
      background-color: rgba(0, 0, 0, 0.55);
      bottom: 0;
      color: #fefefe;
      height: 2rem;
      left: 0;
      line-height: 2.5;
      position: absolute;
      right: 0;
      text-align: center;
      width: 100%; }
      .pag-reconform-ambience input[type=checkbox] + label span:hover {
        background-color: rgba(231, 86, 53, 0.9); }
  .pag-reconform-ambience input:checked + label span {
    background-color: rgba(231, 86, 53, 0.9); }
  .pag-reconform-ambience input:disabled + label {
    opacity: 0.5; }
  .pag-reconform-ambience .row .row {
    margin-bottom: -0.875rem;
    margin-top: -0.875rem; }
  .pag-reconform-ambience .row .column.double, .pag-reconform-ambience .row .double.columns, .pag-reconform-ambience .row .column.single, .pag-reconform-ambience .row .single.columns {
    height: 10rem; }
  @media only screen and (min-width: 640px) {
    .pag-reconform-ambience .row .column.double, .pag-reconform-ambience .row .double.columns {
      height: 20rem; } }

.pag-reconform-basic {
  max-width: 32rem; }

.pag-reconform-comment {
  color: #757575;
  font-size: 0.875rem;
  margin-top: 0.5rem; }

.pag-reconform-credentials.row {
  margin-bottom: 1rem;
  margin-left: -0.5rem;
  margin-right: -0.5rem; }

.pag-reconform-credentials .column, .pag-reconform-credentials .columns {
  padding: 0.5rem; }

.pag-reconform-form {
  padding: 0.5rem; }
  @media only screen and (min-width: 640px) {
    .pag-reconform-form {
      padding: 1rem 1.5rem; } }

.pag-reconform-legaltext {
  color: #757575;
  font-size: 0.875rem;
  margin-top: 0.5rem;
  text-align: left; }
  .pag-reconform-legaltext a {
    font-size: 0.875rem; }

.pag-reconform-map {
  height: 12rem;
  margin-top: 0.5rem;
  width: 100%; }
  @media only screen and (min-width: 960px) {
    .pag-reconform-map {
      height: 20rem; } }

.pag-reconform-message {
  margin-bottom: 1rem; }

.pag-reconform-recap {
  margin-bottom: 1rem; }
  .pag-reconform-recap .row .column, .pag-reconform-recap .row .columns {
    padding-bottom: 0.5rem;
    padding-top: 0.5rem; }

.pag-reconform-recapelement {
  color: #757575; }

.pag-reconform-recapvalue {
  color: #333;
  margin-left: 0.25rem; }

.pag-reconform-servicesamenities {
  margin-bottom: 2rem;
  margin-top: 0.5rem; }
  .pag-reconform-servicesamenities .row .column, .pag-reconform-servicesamenities .row .columns {
    padding-bottom: 0;
    padding-top: 0; }

.pag-reconform-situation {
  margin-bottom: 0.75rem; }
  .pag-reconform-situation input + label {
    height: 100%;
    width: 100%; }
    .pag-reconform-situation input + label:before {
      background-clip: content-box;
      background-position: center;
      background-repeat: no-repeat;
      background-size: cover;
      border: none;
      border-radius: 0;
      top: 0;
      height: 100%;
      width: 100%; }
    .pag-reconform-situation input + label:after {
      display: none; }
    .pag-reconform-situation input + label span {
      background-color: rgba(0, 0, 0, 0.35);
      bottom: 0;
      color: #fefefe;
      font-size: 1.85rem;
      font-weight: 700;
      left: 0;
      position: absolute;
      right: 0;
      text-align: center;
      text-shadow: 1px 1px #111;
      top: 0;
      width: 100%; }
      .pag-reconform-situation input + label span:hover {
        background-color: rgba(231, 86, 53, 0.9); }
  .pag-reconform-situation input:checked + label span {
    background-color: rgba(231, 86, 53, 0.9); }
  .pag-reconform-situation .row .row {
    margin-bottom: -0.875rem;
    margin-top: -0.875rem; }
  .pag-reconform-situation .row .column.double, .pag-reconform-situation .row .double.columns, .pag-reconform-situation .row .column.single, .pag-reconform-situation .row .single.columns {
    height: 10rem; }
    .pag-reconform-situation .row .column.double input + label span, .pag-reconform-situation .row .double.columns input + label span, .pag-reconform-situation .row .column.single input + label span, .pag-reconform-situation .row .single.columns input + label span {
      line-height: 8rem; }
  @media only screen and (min-width: 640px) {
    .pag-reconform-situation .row .column.double, .pag-reconform-situation .row .double.columns {
      height: 20rem; } }
  @media only screen and (min-width: 640px) {
    .pag-reconform-situation .row .column.double input + label span, .pag-reconform-situation .row .double.columns input + label span {
      line-height: 18rem; } }

.pag-reconlist .cmp-tilebooking-wrapper {
  height: 8rem; }

.pag-reconlist-create {
  border-radius: 2px;
  border: 5px dashed #eee; }

.pag-reconlist-createcontent {
  left: 0;
  position: absolute;
  right: 0;
  top: 50%;
  -ms-transform: translateY(-50%);
      transform: translateY(-50%); }

.pag-reconlist-createicon {
  font-size: 4rem;
  display: block; }

.pag-referralpage-button {
  margin-bottom: 1.5rem; }

.pag-referralpage-code {
  margin-bottom: 1.5rem; }

@media only screen and (min-width: 960px) {
  .pag-referralpage-container {
    -ms-flex-align: center;
        align-items: center; } }

@media only screen and (min-width: 960px) {
  .pag-referralpage-container {
    text-align: center; } }

.pag-referralpage-desctext {
  margin: 0.5rem 0; }

.pag-referralpage-header {
  margin-bottom: 1rem;
  margin-top: 1.5rem; }

.pag-referralpage-heroimg {
  max-width: 30rem; }

.pag-referralpage-morebtn {
  margin-top: 0.5rem; }

@media only screen and (min-width: 960px) {
  .pag-referralpage-spacescontainer {
    -ms-flex-pack: center;
        justify-content: center; } }

.pag-rfpcreate .lyt-sided {
  margin: 0.75rem auto 0;
  padding: 0 0.75rem; }
  @media only screen and (min-width: 960px) {
    .pag-rfpcreate .lyt-sided {
      margin: 1.25rem auto 0; } }
  @media only screen and (min-width: 640px) {
    .pag-rfpcreate .lyt-sided {
      max-width: 640px; } }
  @media only screen and (min-width: 960px) {
    .pag-rfpcreate .lyt-sided {
      max-width: 920px; } }
  @media only screen and (min-width: 1280px) {
    .pag-rfpcreate .lyt-sided {
      max-width: 1160px; } }
  @media only screen and (min-width: 1600px) {
    .pag-rfpcreate .lyt-sided {
      max-width: 1160px; } }
  @media only screen and (min-width: 640px) {
    .pag-rfpcreate .lyt-sided {
      padding: 0 20px; } }

@media only screen and (min-width: 960px) {
  .pag-rfpcreate .lyt-sided {
    position: relative; } }

@media only screen and (min-width: 960px) {
  .pag-rfpcreate .lyt-sided:after {
    content: ""; } }

@media only screen and (min-width: 960px) {
  .pag-rfpcreate .lyt-sided:after {
    display: table; } }

@media only screen and (min-width: 960px) {
  .pag-rfpcreate .lyt-sided:after {
    clear: both; } }

.pag-rfpcreate .lyt-sided .lyt-sided-aside {
  width: 100%; }
  @media only screen and (min-width: 960px) {
    .pag-rfpcreate .lyt-sided .lyt-sided-aside {
      float: right; } }
  @media only screen and (min-width: 960px) {
    .pag-rfpcreate .lyt-sided .lyt-sided-aside {
      width: 320px; } }
  .pag-rfpcreate .lyt-sided .lyt-sided-aside + .lyt-sided-main {
    margin-top: 2.5rem; }
    @media only screen and (min-width: 960px) {
      .pag-rfpcreate .lyt-sided .lyt-sided-aside + .lyt-sided-main {
        margin-top: 0; } }

.pag-rfpcreate .lyt-sided .lyt-sided-main {
  width: 100%; }
  @media only screen and (min-width: 960px) {
    .pag-rfpcreate .lyt-sided .lyt-sided-main {
      float: left; } }
  @media only screen and (min-width: 960px) {
    .pag-rfpcreate .lyt-sided .lyt-sided-main {
      width: 520px; } }
  @media only screen and (min-width: 1280px) {
    .pag-rfpcreate .lyt-sided .lyt-sided-main {
      width: 760px; } }
  @media only screen and (min-width: 1600px) {
    .pag-rfpcreate .lyt-sided .lyt-sided-main {
      width: 760px; } }
  .pag-rfpcreate .lyt-sided .lyt-sided-main + .lyt-sided-aside {
    margin-top: 2.5rem; }
    @media only screen and (min-width: 960px) {
      .pag-rfpcreate .lyt-sided .lyt-sided-main + .lyt-sided-aside {
        margin-top: 0; } }
    @media only screen and (min-width: 1280px) {
      .pag-rfpcreate .lyt-sided .lyt-sided-main + .lyt-sided-aside .lyt-sided-aside-fixed {
        position: fixed; } }
    @media only screen and (min-width: 1280px) {
      .pag-rfpcreate .lyt-sided .lyt-sided-main + .lyt-sided-aside .lyt-sided-aside-fixed {
        width: 320px; } }

.pag-rfpdetail-accordion {
  margin-left: -1rem; }

.pag-rfpdetail-comment {
  margin-bottom: 0.5rem; }

.pag-rfpdetail-export {
  display: block;
  margin-bottom: 1rem; }

.pag-rfpdetail-intro {
  margin-bottom: 2.5rem; }

.pag-rfpdetail-items {
  scrollbar-width: thin;
  scrollbar-color: #e3e3e3 transparent;
  overflow-x: scroll;
  white-space: nowrap;
  margin: 1rem -0.625rem; }
  .pag-rfpdetail-items::-webkit-scrollbar {
    height: 6px; }
  .pag-rfpdetail-items::-webkit-scrollbar-thumb {
    background-color: #e3e3e3;
    border-radius: 2px; }

.pag-rfpdetail-recap {
  margin-bottom: 0.5rem;
  max-width: 30rem; }

.pag-rfpdetail-subtitle {
  color: #757575; }

.pag-rfpdetail-title {
  margin-bottom: 0.25rem; }

.pag-rfplist .cmp-tilebooking-wrapper {
  height: 8rem; }

.pag-reviewguest {
  background-color: #f7f7f7;
  background-repeat: no-repeat;
  background-position: center center;
  background-attachment: fixed;
  background-size: cover; }
  .pag-reviewguest .lyt-footer {
    margin-top: 4rem; }
    @media only screen and (min-width: 1280px) {
      .pag-reviewguest .lyt-footer {
        margin-top: 8rem; } }

.pag-reviewguest-extra {
  margin-top: 0.5rem;
  text-align: center; }

.pag-reviewguest-logo {
  display: block;
  margin-bottom: 0.7rem;
  opacity: 0.75;
  text-align: center; }
  @media only screen and (min-width: 640px) {
    .pag-reviewguest-logo {
      margin-bottom: 1rem; } }
  .pag-reviewguest-logo img {
    max-width: 7rem; }
    @media only screen and (min-width: 640px) {
      .pag-reviewguest-logo img {
        max-width: 10rem; } }

.pag-reviewguest-text {
  font-size: 0.875rem;
  color: #aaa; }
  .pag-reviewguest-text a {
    font-size: 0.875rem; }

.pag-reviewguest-title {
  margin-bottom: 0.5rem; }

.pag-reviewguest-wrapper {
  margin: 0 auto;
  max-width: 24.25rem;
  padding: 0.875rem; }
  @media only screen and (min-width: 640px) {
    .pag-reviewguest-wrapper {
      max-width: 25.5rem; } }
  @media only screen and (min-width: 640px) {
    .pag-reviewguest-wrapper {
      padding: 2.5rem 0 0; } }
  @media only screen and (min-width: 1280px) {
    .pag-reviewguest-wrapper {
      padding: 5rem 0 0; } }
  .pag-reviewguest-wrapper .card {
    padding: 0.875rem; }
    @media only screen and (min-width: 640px) {
      .pag-reviewguest-wrapper .card {
        padding: 1.5rem; } }

.pag-schedule .fc-timegrid-axis, .pag-schedule .fc-timegrid-slot-minor:first-child {
  background-color: #e3e3e3; }

.pag-schedule .fc-theme-standard .fc-scrollgrid {
  border-left: 5px solid #757575; }

.pag-schedule .fc-icon-fontawesome {
  font-family: FontAwesome !important; }

.pag-schedule .fc .fc-button .fc-icon-fontawesome {
  font-size: 1.2em; }

.pag-schedule .sb-cal-dateclicked {
  z-index: 100 !important; }

.pag-schedule-action {
  padding-bottom: 0.5rem;
  padding-right: 1.5rem; }

.pag-schedule-actions {
  margin: 1rem auto; }
  @media only screen and (min-width: 640px) {
    .pag-schedule-actions {
      margin: 2rem auto; } }

.pag-schedule-data {
  margin-bottom: 1.5rem;
  margin-top: 1rem; }
  @media only screen and (min-width: 640px) {
    .pag-schedule-data {
      position: relative; } }

.pag-schedule-help {
  background-color: #50aaeb;
  background-repeat: no-repeat;
  background-position: center center;
  background-attachment: scroll;
  background-size: cover;
  color: #fefefe;
  margin: 0 0 2rem;
  padding: 0.5rem 2rem; }
  .pag-schedule-help a {
    color: #fefefe;
    text-decoration: underline; }

.pag-schedule-helpbutton {
  display: block;
  margin-top: 0.25rem; }

.pag-schedule-helptext {
  margin-top: 0.25rem; }

.pag-schedule-helptitle {
  font-weight: bold; }

.pag-schedule-spaces {
  margin-left: 2rem; }

.pag-schedule-toggle a {
  margin-left: 0.35rem; }

.pag-schedule-toggle input[type=checkbox] + label {
  border: 1px solid #aaa;
  border-radius: 0.75rem;
  color: black;
  display: inline-block;
  margin-bottom: 0.35rem;
  padding: 0.35rem 0.6rem 0.35rem 2.2rem; }

.pag-schedule-toggle input[type=checkbox] + label:before {
  background-color: transparent;
  border-radius: 50%;
  height: 1.1rem;
  left: 0.6rem;
  top: 0.35rem;
  width: 1.1rem; }

.pag-schedule-toggle input[type=checkbox]:checked + label {
  background-color: #e3e3e3; }

.pag-schedule-toggle input[type=checkbox]:checked + label:after {
  left: 0.85rem;
  top: 0.5rem; }

.pag-schedule-toggle input[type=checkbox]:checked + label:before {
  background-color: #fefefe;
  left: 0.7rem;
  top: 0.4rem; }

.pag-schedule-venue {
  margin-top: 0.5rem; }

.pag-seoflatpages .lyt-sided {
  margin: 0.75rem auto 0;
  padding: 0 0.75rem; }
  @media only screen and (min-width: 960px) {
    .pag-seoflatpages .lyt-sided {
      margin: 1.25rem auto 0; } }
  @media only screen and (min-width: 640px) {
    .pag-seoflatpages .lyt-sided {
      max-width: 640px; } }
  @media only screen and (min-width: 960px) {
    .pag-seoflatpages .lyt-sided {
      max-width: 920px; } }
  @media only screen and (min-width: 1280px) {
    .pag-seoflatpages .lyt-sided {
      max-width: 1160px; } }
  @media only screen and (min-width: 1600px) {
    .pag-seoflatpages .lyt-sided {
      max-width: 1400px; } }
  @media only screen and (min-width: 640px) {
    .pag-seoflatpages .lyt-sided {
      padding: 0 20px; } }

@media only screen and (min-width: 960px) {
  .pag-seoflatpages .lyt-sided {
    position: relative; } }

@media only screen and (min-width: 960px) {
  .pag-seoflatpages .lyt-sided:after {
    content: ""; } }

@media only screen and (min-width: 960px) {
  .pag-seoflatpages .lyt-sided:after {
    display: table; } }

@media only screen and (min-width: 960px) {
  .pag-seoflatpages .lyt-sided:after {
    clear: both; } }

.pag-seoflatpages .lyt-sided .lyt-sided-aside {
  width: 100%; }
  @media only screen and (min-width: 960px) {
    .pag-seoflatpages .lyt-sided .lyt-sided-aside {
      float: right; } }
  @media only screen and (min-width: 960px) {
    .pag-seoflatpages .lyt-sided .lyt-sided-aside {
      width: 320px; } }
  .pag-seoflatpages .lyt-sided .lyt-sided-aside + .lyt-sided-main {
    margin-top: 2.5rem; }
    @media only screen and (min-width: 960px) {
      .pag-seoflatpages .lyt-sided .lyt-sided-aside + .lyt-sided-main {
        margin-top: 0; } }

.pag-seoflatpages .lyt-sided .lyt-sided-main {
  width: 100%; }
  @media only screen and (min-width: 960px) {
    .pag-seoflatpages .lyt-sided .lyt-sided-main {
      float: left; } }
  @media only screen and (min-width: 960px) {
    .pag-seoflatpages .lyt-sided .lyt-sided-main {
      width: 520px; } }
  @media only screen and (min-width: 1280px) {
    .pag-seoflatpages .lyt-sided .lyt-sided-main {
      width: 760px; } }
  @media only screen and (min-width: 1600px) {
    .pag-seoflatpages .lyt-sided .lyt-sided-main {
      width: 1000px; } }
  .pag-seoflatpages .lyt-sided .lyt-sided-main + .lyt-sided-aside {
    margin-top: 2.5rem; }
    @media only screen and (min-width: 960px) {
      .pag-seoflatpages .lyt-sided .lyt-sided-main + .lyt-sided-aside {
        margin-top: 0; } }
    @media only screen and (min-width: 1280px) {
      .pag-seoflatpages .lyt-sided .lyt-sided-main + .lyt-sided-aside .lyt-sided-aside-fixed {
        position: fixed; } }
    @media only screen and (min-width: 1280px) {
      .pag-seoflatpages .lyt-sided .lyt-sided-main + .lyt-sided-aside .lyt-sided-aside-fixed {
        width: 320px; } }

@media only screen and (min-width: 1280px) {
  .pag-seoflatpages .lyt-sided .lyt-sided-main {
    min-height: 30rem; } }

.pag-seoflatpages .cmp-assistantsection {
  padding: 1.25rem; }

@media only screen and (min-width: 640px) {
  .pag-seoflatpages .cmp-assistantsection-content {
    margin-left: 3.5rem; } }

@media only screen and (min-width: 1280px) {
  .pag-seoflatpages .cmp-assistantsection-content {
    margin-left: 5rem; } }

@media only screen and (min-width: 640px) {
  .pag-seoflatpages .cmp-assistantsection-photo {
    height: 3rem; } }

@media only screen and (min-width: 1280px) {
  .pag-seoflatpages .cmp-assistantsection-photo {
    height: 4rem; } }

@media only screen and (min-width: 640px) {
  .pag-seoflatpages .cmp-assistantsection-photo {
    width: 3rem; } }

@media only screen and (min-width: 1280px) {
  .pag-seoflatpages .cmp-assistantsection-photo {
    width: 4rem; } }

.pag-seoflatpages .cmp-tilelist-arrow {
  display: none; }

.pag-seoflatpages-description {
  margin-bottom: 1rem; }

.pag-seoflatpages-headersection {
  background-repeat: no-repeat;
  background-position: center;
  background-size: cover;
  width: 100%;
  padding-bottom: 200px; }
  @media only screen and (min-width: 960px) {
    .pag-seoflatpages-headersection {
      padding-bottom: 300px; } }

.pag-seoflatpages-highlight {
  color: #50aaeb;
  font-weight: bold; }

.pag-seoflatpages-section {
  padding-top: 1.5rem;
  margin-bottom: 1.25rem; }
  .pag-seoflatpages-section + .pag-seoflatpages-section {
    border-top: 1px solid #ccc; }

.pag-seoflatpages-sectiontext {
  color: #757575; }

.pag-seoflatpages-table {
  background-color: #f7f7f7; }
  .pag-seoflatpages-table td, .pag-seoflatpages-table th {
    border: 1px solid #aaa; }
  .pag-seoflatpages-table td:not(:last-child), .pag-seoflatpages-table th:not(:last-child) {
    border-right: 1px solid #eee; }
  .pag-seoflatpages-table th {
    font-weight: normal; }

.pag-seoflatpages-subtitle {
  font-weight: bold;
  margin-bottom: 1rem; }

.pag-seositemap-grid.row {
  margin-left: -0.25rem;
  margin-right: -0.25rem; }
  .pag-seositemap-grid.row .column, .pag-seositemap-grid.row .columns {
    padding: 0.25rem; }

.pag-seositemap-section {
  margin-bottom: 1.5rem; }

.pag-seositemap-sectionsubtitle {
  margin-bottom: 0.5rem; }

.pag-seositemap-sectiontitle {
  margin-bottom: 0.75rem; }

.pag-seositemap-title {
  color: #aaa;
  margin: 2.5rem 0;
  text-transform: uppercase; }

.pag-spacedashboard .cmp-reviewelement-body {
  color: #757575;
  font-size: 0.875rem; }

.pag-spacedashboard .cmp-reviewelement-ratingagain {
  color: #757575; }

.pag-spacedashboard .cmp-reviewelement-ratingstar {
  color: #757575; }

.pag-spacedashboard-chartlegend + .pag-spacedashboard-chartlegend {
  padding-top: 0.25rem; }

.pag-spacedashboard-chartswatch {
  border: 2px solid;
  display: inline-block;
  height: 0.2rem;
  margin: 0.2rem 0.5rem;
  width: 2.5rem; }
  .pag-spacedashboard-chartswatch.blue {
    background-color: transparent !important;
    border-color: #214096;
    border-style: dashed; }
  .pag-spacedashboard-chartswatch.secondary {
    border-color: #50aaeb; }

.pag-spacedashboard-charttext {
  padding-top: 0.5rem; }

.pag-spacedashboard-chartvalue {
  font-weight: bold;
  margin-left: 0.25rem; }

.pag-spacedashboard-check {
  position: relative; }
  .pag-spacedashboard-check + .pag-spacedashboard-check {
    margin-top: 1.5rem; }

.pag-spacedashboard-checkcontent {
  margin-right: 2.5rem; }

.pag-spacedashboard-checkicon {
  margin: 0;
  padding: 0.45em 0.35em 0 0.35em;
  position: absolute;
  right: 0;
  top: 0; }
  .pag-spacedashboard-checkicon.fa-warning {
    padding-left: 0.4em;
    padding-right: 0.3em; }

.pag-spacedashboard-checklist {
  color: #757575;
  list-style-type: circle;
  margin-top: 0.25rem; }

.pag-spacedashboard-code textarea {
  height: 5rem;
  margin-top: 0.5rem; }

.pag-spacedashboard-code + .pag-spacedashboard-code {
  margin-top: 1.5rem; }

.pag-spacedashboard-codeaction {
  margin-top: 0.25rem; }

.pag-spacedashboard-comment {
  color: #757575;
  font-size: 0.875rem; }

.pag-spacedashboard-container {
  margin-left: auto;
  margin-right: auto;
  max-width: 484px;
  padding: 0 0.75rem; }
  @media only screen and (min-width: 1280px) {
    .pag-spacedashboard-container {
      max-width: 960px; } }
  @media only screen and (min-width: 1280px) {
    .pag-spacedashboard-container {
      padding: 0; } }

.pag-spacedashboard-conversation {
  position: relative;
  padding-bottom: 0.5rem; }

.pag-spacedashboard-conversationcircle {
  background-color: #ccc;
  border-radius: 50%;
  height: 0.5rem;
  position: absolute;
  top: 0.8rem;
  width: 0.5rem; }

.pag-spacedashboard-conversationcontent {
  margin-left: 2.5rem; }

.pag-spacedashboard-conversationcontentdate {
  color: #757575;
  font-size: 0.875rem;
  margin-left: 0.5rem; }

.pag-spacedashboard-conversationcontentmessages {
  font-size: 0.875rem; }
  .pag-spacedashboard-conversationcontentmessages.primary {
    color: #e75635; }

.pag-spacedashboard-conversationcontentuser {
  font-weight: bold; }

.pag-spacedashboard-conversationicon, .pag-spacedashboard-conversationmultiple, .pag-spacedashboard-conversationpicture {
  height: 2rem;
  padding: 0.25rem 0;
  position: absolute;
  width: 2rem; }

.pag-spacedashboard-conversationicon {
  border-radius: 50%;
  color: #fefefe;
  margin: 0 auto;
  text-align: center; }
  .pag-spacedashboard-conversationicon:empty:after {
    content: "\f007";
    font-family: "FontAwesome"; }

.pag-spacedashboard-conversationmultiple {
  border-radius: 50%;
  color: #fefefe;
  margin: 0 auto;
  padding: 0.5rem 0 0;
  text-align: center; }

.pag-spacedashboard-conversationpicture {
  background-color: #fefefe;
  background-position: center;
  background-repeat: no-repeat;
  background-size: cover;
  border-radius: 50%; }

.pag-spacedashboard-grid.row {
  margin-left: -1.25rem;
  margin-right: -1.25rem; }
  .pag-spacedashboard-grid.row > .column, .pag-spacedashboard-grid.row > .columns {
    padding-left: 1.25rem;
    padding-right: 1.25rem; }

.pag-spacedashboard-help {
  margin-top: 2.5rem;
  position: relative; }
  .pag-spacedashboard-help + .pag-spacedashboard-link {
    bottom: 1rem;
    right: 1.25rem;
    padding: 0;
    position: absolute; }

.pag-spacedashboard-helpcontent {
  margin-left: 2rem; }

.pag-spacedashboard-helpicon {
  font-size: 1.5rem;
  margin: 0;
  position: absolute;
  top: 0.2rem; }

.pag-spacedashboard-hire {
  position: relative;
  padding-bottom: 0.5rem; }

.pag-spacedashboard-hirecontent {
  margin-left: 2.5rem; }

.pag-spacedashboard-hireicon, .pag-spacedashboard-hirepicture {
  height: 2rem;
  padding: 0.25rem 0;
  position: absolute;
  width: 2rem; }

.pag-spacedashboard-hireicon {
  border-radius: 50%;
  color: #fefefe;
  margin: 0 auto;
  text-align: center; }
  .pag-spacedashboard-hireicon:empty:after {
    content: "\f007";
    font-family: "FontAwesome"; }

.pag-spacedashboard-hirepicture {
  background-color: #fefefe;
  background-position: center;
  background-repeat: no-repeat;
  background-size: cover;
  border-radius: 50%; }

.pag-spacedashboard-link {
  bottom: -0.5rem;
  position: relative;
  text-align: right; }

.pag-spacedashboard-section {
  margin-bottom: 2rem;
  margin-top: 0.25rem;
  padding: 0.75rem;
  position: relative; }
  @media only screen and (min-width: 640px) {
    .pag-spacedashboard-section {
      padding: 1.25rem; } }

.pag-spacedashboard-similar {
  margin-bottom: 0.75rem; }
  .pag-spacedashboard-similar.row {
    margin-right: 0;
    margin-left: 10px; }
    .pag-spacedashboard-similar.row .column, .pag-spacedashboard-similar.row .columns {
      padding: 0 0.25rem; }

.pag-spacedashboard-similarimage {
  background-size: cover;
  background-position: center center;
  background-repeat: no-repeat;
  height: 3.2rem;
  width: 100%; }

.pag-spacedashboard-tip {
  background-color: #f0f8fd;
  border-left: 4px solid #50aaeb;
  position: relative; }

.pag-spacedashboard-tipcontent {
  margin-left: 2.5rem; }

.pag-spacedashboard-tipicon {
  color: #50aaeb;
  font-size: 2.5rem;
  position: absolute; }

.pag-spacedashboard-tiplist {
  color: #757575;
  list-style-type: circle; }
  .pag-spacedashboard-tiplist li {
    font-size: 0.875rem; }

.pag-spacedashboard-tiptitle {
  font-weight: bold;
  margin-bottom: 0.5rem; }

.pag-spacedashboard-title {
  color: #757575; }

.pag-styleguide-content {
  padding-bottom: 5rem;
  padding-top: 5rem; }

.pag-styleguide-element {
  margin-bottom: 1.25rem;
  margin-top: 2.5rem; }

.pag-styleguide-header {
  margin-bottom: 2.5rem; }

.pag-styleguide-sectionwrapper {
  border-top: 1px solid #aaa;
  padding-top: 2.5rem;
  margin-top: 2.5rem; }

.pag-subscriptionsform .lyt-container {
  padding-top: 2rem; }
  @media only screen and (min-width: 960px) {
    .pag-subscriptionsform .lyt-container {
      padding-top: 4rem; } }

.pag-subscriptionsform-explanation {
  background-color: #f7f7f7;
  margin: 2rem auto;
  padding: 1rem 1.5rem;
  text-align: center; }

.pag-subscriptionsform-grid.row {
  margin-left: -1rem;
  margin-right: -1rem; }
  @media only screen and (min-width: 960px) {
    .pag-subscriptionsform-grid.row {
      margin-left: -3.75rem; } }
  @media only screen and (min-width: 960px) {
    .pag-subscriptionsform-grid.row {
      margin-right: -3.75rem; } }

.pag-subscriptionsform-grid .column, .pag-subscriptionsform-grid .columns {
  padding: 0 1rem; }
  @media only screen and (min-width: 960px) {
    .pag-subscriptionsform-grid .column, .pag-subscriptionsform-grid .columns {
      padding: 0 3.75rem; } }

.pag-subscriptionsform-note {
  color: #757575;
  margin-bottom: 2rem;
  margin-top: 1rem; }

.pag-subscriptionsform-payment {
  margin-top: 2rem;
  padding: 2rem; }

.pag-subscriptionsform-paymentbutton {
  margin-top: 2rem;
  min-width: 10rem; }

.pag-subscriptionsform-paymentcomment {
  margin: 1rem 0 0.5rem 0; }

.pag-subscriptionsform-paymentdivider {
  padding: 1rem; }

.pag-subscriptionsform-paymentinvoice {
  margin-top: 1rem; }

.pag-subscriptionsform-paymentnote {
  color: #757575;
  font-size: 0.875rem;
  margin-top: 1rem; }
  .pag-subscriptionsform-paymentnote a {
    font-size: 0.875rem; }

.pag-subscriptionsform-paymentrecap {
  margin-top: 2rem; }

.pag-subscriptionsform-selector {
  margin: 2rem auto;
  max-width: 25rem; }

.pag-subscriptionsform-selectorchoice {
  border-bottom: 4px solid #aaa;
  padding: 0.5rem 1rem; }
  .pag-subscriptionsform-selectorchoice.selected {
    border-bottom-color: #e75635; }

.pag-subscriptionslist-help {
  color: #757575;
  font-size: 0.875rem; }

.pag-subscriptionslist-helpwarn {
  color: #ffae00;
  font-size: 0.875rem; }

.pag-subscriptionslist-intro {
  padding-bottom: 1rem;
  position: relative;
  top: -1.25rem; }

.pag-subscriptionslist-label {
  color: #757575;
  font-size: 0.875rem; }

.pag-subscriptionslist-name {
  background-color: #333;
  color: white;
  left: 0;
  margin: 0 auto;
  padding: 0.5rem 0.75rem;
  position: absolute;
  right: 0;
  top: 0;
  -ms-transform: translate(0, -50%);
      transform: translate(0, -50%);
  width: 80%; }

.pag-subscriptionslist-section {
  margin-top: 3rem;
  padding: 1.25rem 1.75rem; }
  @media only screen and (min-width: 640px) {
    .pag-subscriptionslist-section {
      margin-top: 4.5rem; } }

.pag-subscriptionslist-table {
  margin-top: 1.5rem; }
  .pag-subscriptionslist-table th {
    text-align: left; }
  .pag-subscriptionslist-table tr:not(:last-child) th, .pag-subscriptionslist-table tr:not(:last-child) td {
    border-bottom: 1px solid #aaa; }

.pag-subscriptionslist-title {
  margin-bottom: 2.5rem; }

.pag-updateinfo-address .cmp-actions {
  text-align: center; }

.pag-updateinfo-buttons {
  margin: 1rem auto 0 auto;
  text-align: center; }

.pag-updateinfo-content {
  margin-bottom: 2rem;
  padding: 4rem 3rem 2rem 3rem;
  position: relative; }

.pag-updateinfo-finishicon i {
  color: #aaa;
  font-size: 5rem;
  margin-bottom: 2rem; }

.pag-updateinfo-finishtitle {
  margin: 1rem 0 2rem 0;
  text-transform: uppercase; }

.pag-updateinfo-finishtext {
  margin: 1rem 0 4rem 0; }

.pag-updateinfo-link {
  left: 1.25rem;
  position: absolute;
  top: 1rem; }
  .pag-updateinfo-link i {
    font-size: 1.5rem; }

.pag-updateinfo-stepper {
  margin-bottom: 0.5rem;
  padding: 1rem 1.5rem; }
  @media only screen and (min-width: 1280px) {
    .pag-updateinfo-stepper {
      margin-bottom: 2rem; } }
  .pag-updateinfo-stepper > .row {
    margin-left: -0.375rem;
    margin-right: -0.375rem; }
    @media only screen and (min-width: 1280px) {
      .pag-updateinfo-stepper > .row {
        left: 0.75rem; } }
    @media only screen and (min-width: 1280px) {
      .pag-updateinfo-stepper > .row {
        position: relative; } }
    .pag-updateinfo-stepper > .row > .column, .pag-updateinfo-stepper > .row > .columns {
      padding: 0 0.375rem; }

.pag-updateinfo-step {
  position: relative; }
  .pag-updateinfo-step a.active .pag-updateinfo-stepnumber {
    background-color: #e75635; }

.pag-updateinfo-stepcomment {
  background-color: #fefefe;
  display: block;
  font-size: 0.875rem;
  margin: 0.2rem auto 0;
  position: relative;
  text-align: center;
  text-transform: none;
  z-index: 100; }
  @media only screen and (min-width: 1280px) {
    .pag-updateinfo-stepcomment {
      display: inline-block; } }
  @media only screen and (min-width: 1280px) {
    .pag-updateinfo-stepcomment {
      margin: 0; } }
  @media only screen and (min-width: 1280px) {
    .pag-updateinfo-stepcomment {
      padding: 0 0.75rem 0 0.25rem; } }
  @media only screen and (min-width: 1280px) {
    .pag-updateinfo-stepcomment {
      text-align: left; } }

.pag-updateinfo-stepline {
  border-bottom: 1px solid #ccc;
  margin-left: 30%;
  position: absolute;
  top: 1rem;
  width: 70%; }

.pag-updateinfo-stepnumber {
  background-color: #aaa;
  border-radius: 50%;
  color: #fefefe;
  display: block;
  height: 2rem;
  line-height: 2.25;
  margin: 0 auto;
  position: relative;
  text-align: center;
  width: 2rem;
  z-index: 100; }
  @media only screen and (min-width: 1280px) {
    .pag-updateinfo-stepnumber {
      display: inline-block; } }
  @media only screen and (min-width: 1280px) {
    .pag-updateinfo-stepnumber {
      margin: 0; } }

.pag-venueclaim-subtitle {
  color: #757575;
  margin-bottom: 2.5rem; }

.pag-venueclaim-title {
  margin-bottom: 0.5rem;
  margin-top: 5rem; }

.pag-venuecreate-subtitle {
  margin-bottom: 2.5rem; }

.pag-venuecreate-title {
  margin-bottom: 0.5rem;
  margin-top: 5rem; }